Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3Z673

Protein Details
Accession A0A2T3Z673    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
176-195PVNQRRSVNKRSERGSRRRLHydrophilic
NLS Segment(s)
PositionSequence
185-195KRSERGSRRRL
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR036908  RlpA-like_sf  
Amino Acid Sequences MKNQMLSSIGLFAASAVAQTVLNSGSGFGTLYYDVSDVNGCQDDFSLQNEGFVECNFFTGLSLDQMNTDYVVAMNYTLLAGDLAKYCGKKVIVTSNGVQSNLPLFIGDGCARCAGGPSTNTAWNPNGAPGLDFSYTVAQELNSNACFAGHFDITWEIVDETLYNFDTNAPGQPTGPVNQRRSVNKRSERGSRRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.04
4 0.05
5 0.05
6 0.05
7 0.07
8 0.06
9 0.07
10 0.07
11 0.07
12 0.06
13 0.07
14 0.07
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.08
24 0.07
25 0.09
26 0.1
27 0.09
28 0.09
29 0.1
30 0.1
31 0.1
32 0.13
33 0.14
34 0.12
35 0.13
36 0.14
37 0.14
38 0.13
39 0.12
40 0.13
41 0.09
42 0.1
43 0.09
44 0.08
45 0.08
46 0.08
47 0.09
48 0.08
49 0.08
50 0.07
51 0.08
52 0.09
53 0.09
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.06
71 0.08
72 0.08
73 0.08
74 0.11
75 0.11
76 0.11
77 0.13
78 0.19
79 0.2
80 0.22
81 0.23
82 0.26
83 0.27
84 0.26
85 0.24
86 0.16
87 0.15
88 0.12
89 0.11
90 0.05
91 0.05
92 0.04
93 0.06
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.08
102 0.09
103 0.09
104 0.12
105 0.14
106 0.17
107 0.17
108 0.19
109 0.18
110 0.17
111 0.17
112 0.15
113 0.13
114 0.11
115 0.11
116 0.09
117 0.12
118 0.11
119 0.11
120 0.1
121 0.12
122 0.11
123 0.11
124 0.11
125 0.08
126 0.08
127 0.1
128 0.11
129 0.1
130 0.1
131 0.1
132 0.09
133 0.09
134 0.09
135 0.12
136 0.09
137 0.09
138 0.1
139 0.11
140 0.12
141 0.12
142 0.12
143 0.08
144 0.08
145 0.08
146 0.07
147 0.07
148 0.09
149 0.09
150 0.08
151 0.08
152 0.09
153 0.11
154 0.11
155 0.14
156 0.15
157 0.15
158 0.15
159 0.18
160 0.2
161 0.22
162 0.31
163 0.35
164 0.37
165 0.43
166 0.49
167 0.56
168 0.61
169 0.66
170 0.68
171 0.69
172 0.73
173 0.74
174 0.78
175 0.79