Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZJ36

Protein Details
Accession A0A2T3ZJ36    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-56NETFDSKPRKGRPKKPTLTEASHydrophilic
NLS Segment(s)
PositionSequence
41-49KPRKGRPKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MCAKISVGKSYRAVAHEFNTSASTAYAIFKRWKDNETFDSKPRKGRPKKPTLTEASSAGKDCERAEGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.26
5 0.24
6 0.21
7 0.19
8 0.16
9 0.14
10 0.12
11 0.08
12 0.1
13 0.1
14 0.11
15 0.15
16 0.16
17 0.22
18 0.24
19 0.25
20 0.27
21 0.31
22 0.33
23 0.36
24 0.38
25 0.38
26 0.45
27 0.45
28 0.5
29 0.53
30 0.59
31 0.61
32 0.69
33 0.74
34 0.76
35 0.82
36 0.81
37 0.82
38 0.79
39 0.74
40 0.67
41 0.61
42 0.54
43 0.47
44 0.41
45 0.34
46 0.28
47 0.23
48 0.21
49 0.23
50 0.21