Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3Z7R8

Protein Details
Accession A0A2T3Z7R8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-79EGPRGKTKWNKKVHGGRVVRBasic
NLS Segment(s)
PositionSequence
64-79GKTKWNKKVHGGRVVR
Subcellular Location(s) mito 16, extr 5, cyto 2, nucl 1, plas 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences FFLTSRCVQRWSFLCVCAWRWVAREHVRLSAGCLRIFLRRTRLVLSRLFGMTILACISEEGPRGKTKWNKKVHGGRVVRPPRGLWGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.37
4 0.35
5 0.35
6 0.28
7 0.28
8 0.28
9 0.33
10 0.37
11 0.4
12 0.36
13 0.37
14 0.37
15 0.35
16 0.37
17 0.35
18 0.3
19 0.24
20 0.23
21 0.21
22 0.23
23 0.26
24 0.24
25 0.24
26 0.24
27 0.26
28 0.28
29 0.31
30 0.29
31 0.29
32 0.28
33 0.24
34 0.21
35 0.19
36 0.16
37 0.13
38 0.1
39 0.08
40 0.07
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.08
47 0.1
48 0.12
49 0.14
50 0.15
51 0.24
52 0.32
53 0.42
54 0.49
55 0.58
56 0.62
57 0.7
58 0.79
59 0.8
60 0.81
61 0.76
62 0.73
63 0.75
64 0.77
65 0.71
66 0.63
67 0.55