Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZHE5

Protein Details
Accession A0A2T3ZHE5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23RINSGRNKKGRGHTKPIRCSNCSHydrophilic
77-107GKIVRVRSREGRRNRAPPPRVRYNKDGKKITBasic
NLS Segment(s)
PositionSequence
81-105RVRSREGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 15, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences RINSGRNKKGRGHTKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKITPTVAPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.87
4 0.84
5 0.78
6 0.78
7 0.77
8 0.76
9 0.75
10 0.72
11 0.69
12 0.7
13 0.72
14 0.71
15 0.72
16 0.71
17 0.73
18 0.74
19 0.76
20 0.72
21 0.73
22 0.68
23 0.68
24 0.6
25 0.53
26 0.46
27 0.37
28 0.35
29 0.27
30 0.25
31 0.15
32 0.14
33 0.12
34 0.1
35 0.1
36 0.08
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.05
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.1
51 0.16
52 0.18
53 0.2
54 0.23
55 0.24
56 0.25
57 0.27
58 0.24
59 0.2
60 0.2
61 0.18
62 0.19
63 0.19
64 0.21
65 0.22
66 0.28
67 0.31
68 0.32
69 0.35
70 0.4
71 0.49
72 0.56
73 0.62
74 0.66
75 0.7
76 0.76
77 0.8
78 0.81
79 0.8
80 0.81
81 0.8
82 0.8
83 0.81
84 0.79
85 0.79
86 0.79
87 0.81
88 0.81
89 0.8
90 0.72
91 0.72
92 0.7
93 0.64
94 0.62