Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3YY56

Protein Details
Accession A0A2T3YY56    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
104-129SKTTNKQPPSPERQQKEKPATKKETYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto_mito 11.999, mito_nucl 10.499, cyto 6.5, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
Pfam View protein in Pfam  
PF00075  RNase_H  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences MATGHSVVIFSDSTSALEQVRKLREKEAVTNAQVISDPIIRKLVTRSQYLHRIGVRVELRWVPGHSGVEGNLRADAAALQAAKAQDMSVHIDEGLRLIELEAISKTTNKQPPSPERQQKEKPATKKETY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.14
5 0.17
6 0.22
7 0.29
8 0.33
9 0.34
10 0.37
11 0.42
12 0.44
13 0.48
14 0.5
15 0.48
16 0.44
17 0.46
18 0.42
19 0.35
20 0.31
21 0.25
22 0.18
23 0.16
24 0.15
25 0.12
26 0.15
27 0.14
28 0.15
29 0.18
30 0.23
31 0.22
32 0.25
33 0.27
34 0.31
35 0.39
36 0.4
37 0.41
38 0.35
39 0.32
40 0.29
41 0.33
42 0.28
43 0.21
44 0.21
45 0.17
46 0.18
47 0.18
48 0.18
49 0.13
50 0.13
51 0.13
52 0.11
53 0.11
54 0.1
55 0.11
56 0.11
57 0.1
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.04
64 0.05
65 0.05
66 0.05
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.07
74 0.12
75 0.1
76 0.11
77 0.11
78 0.11
79 0.11
80 0.11
81 0.1
82 0.05
83 0.05
84 0.04
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.09
91 0.1
92 0.13
93 0.2
94 0.26
95 0.28
96 0.33
97 0.42
98 0.51
99 0.59
100 0.68
101 0.7
102 0.71
103 0.78
104 0.82
105 0.83
106 0.84
107 0.84
108 0.83
109 0.83