Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3YWZ1

Protein Details
Accession A0A2T3YWZ1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
331-356ASKVPGLRRWVEKKRAKKEVNEFEVFHydrophilic
NLS Segment(s)
PositionSequence
342-347EKKRAK
Subcellular Location(s) plas 21, E.R. 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004923  FTR1/Fip1/EfeU  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0033573  C:high-affinity iron permease complex  
GO:0005381  F:iron ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF03239  FTR1  
Amino Acid Sequences MAKNVFAVQIFFIVFRECLEAVIIISVLLSFLKQCLGGPGQDQAIYKRLVRQVWLGSAAGIVICLIIGGAFIGAFYGLGKDIWSQSEDLWEGIFYLIATIIVSIMGLALLRINKMKDKWRVKIAHALAEKSGNSEKPRNWLSDWSRRHVMFILPFITTLREGVEAVVFVGGVSLSLPATAFPLPVVCGIIAGLAVGFFIYRGGNLMSIQLFLIASTSVLYLIAAGMFSKSIWSLQYHTFAQRVGSDVAEEGNGPGSYNILETVWHVNCCNPETDNGWDVFNSILGWQNTATYGSVIAYNVYWIFLVLTVSLLMYEEKTGSLPLKNQFLNTASKVPGLRRWVEKKRAKKEVNEFEVFQQVQAAGLLRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.15
4 0.13
5 0.13
6 0.14
7 0.13
8 0.11
9 0.12
10 0.11
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.05
17 0.04
18 0.05
19 0.06
20 0.07
21 0.07
22 0.12
23 0.14
24 0.15
25 0.16
26 0.19
27 0.19
28 0.22
29 0.23
30 0.2
31 0.23
32 0.23
33 0.23
34 0.27
35 0.31
36 0.3
37 0.31
38 0.34
39 0.34
40 0.35
41 0.36
42 0.29
43 0.24
44 0.22
45 0.19
46 0.13
47 0.09
48 0.06
49 0.03
50 0.03
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.05
67 0.06
68 0.08
69 0.09
70 0.11
71 0.11
72 0.11
73 0.14
74 0.14
75 0.13
76 0.12
77 0.11
78 0.1
79 0.09
80 0.09
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.04
96 0.05
97 0.06
98 0.08
99 0.1
100 0.14
101 0.18
102 0.26
103 0.35
104 0.43
105 0.47
106 0.55
107 0.58
108 0.57
109 0.62
110 0.56
111 0.54
112 0.48
113 0.43
114 0.35
115 0.33
116 0.3
117 0.24
118 0.24
119 0.19
120 0.21
121 0.26
122 0.26
123 0.3
124 0.33
125 0.33
126 0.32
127 0.38
128 0.41
129 0.46
130 0.48
131 0.47
132 0.49
133 0.46
134 0.46
135 0.39
136 0.35
137 0.26
138 0.25
139 0.21
140 0.16
141 0.16
142 0.15
143 0.14
144 0.11
145 0.09
146 0.08
147 0.07
148 0.07
149 0.07
150 0.07
151 0.05
152 0.05
153 0.05
154 0.04
155 0.03
156 0.03
157 0.02
158 0.02
159 0.02
160 0.03
161 0.02
162 0.03
163 0.03
164 0.03
165 0.05
166 0.05
167 0.05
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.03
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.03
187 0.03
188 0.04
189 0.04
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.03
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.06
219 0.07
220 0.1
221 0.13
222 0.17
223 0.18
224 0.2
225 0.2
226 0.19
227 0.19
228 0.16
229 0.17
230 0.14
231 0.12
232 0.11
233 0.1
234 0.1
235 0.09
236 0.08
237 0.06
238 0.07
239 0.06
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.07
246 0.05
247 0.05
248 0.07
249 0.13
250 0.14
251 0.14
252 0.15
253 0.16
254 0.19
255 0.2
256 0.2
257 0.15
258 0.16
259 0.18
260 0.22
261 0.22
262 0.21
263 0.2
264 0.18
265 0.18
266 0.16
267 0.13
268 0.09
269 0.07
270 0.12
271 0.12
272 0.13
273 0.12
274 0.13
275 0.13
276 0.14
277 0.14
278 0.08
279 0.08
280 0.08
281 0.09
282 0.08
283 0.08
284 0.07
285 0.08
286 0.08
287 0.08
288 0.07
289 0.06
290 0.06
291 0.06
292 0.07
293 0.06
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.07
302 0.07
303 0.07
304 0.08
305 0.1
306 0.12
307 0.14
308 0.19
309 0.23
310 0.29
311 0.3
312 0.3
313 0.32
314 0.33
315 0.36
316 0.34
317 0.34
318 0.29
319 0.32
320 0.33
321 0.33
322 0.37
323 0.37
324 0.39
325 0.44
326 0.53
327 0.6
328 0.68
329 0.74
330 0.78
331 0.82
332 0.88
333 0.85
334 0.85
335 0.86
336 0.86
337 0.85
338 0.78
339 0.7
340 0.62
341 0.63
342 0.54
343 0.42
344 0.33
345 0.25
346 0.2
347 0.19