Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZIM5

Protein Details
Accession A0A2T3ZIM5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-66TGRQQMAWKKTKRHPRSNCVLAENHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAQTPVLVISIVTSGSSILCSIWAVCLQLVGQAKSSNQCASVTGRQQMAWKKTKRHPRSNCVLAENQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.09
16 0.11
17 0.1
18 0.11
19 0.11
20 0.12
21 0.13
22 0.15
23 0.11
24 0.11
25 0.1
26 0.11
27 0.15
28 0.2
29 0.22
30 0.23
31 0.23
32 0.23
33 0.29
34 0.35
35 0.37
36 0.42
37 0.45
38 0.51
39 0.59
40 0.69
41 0.74
42 0.78
43 0.8
44 0.81
45 0.85
46 0.84
47 0.81
48 0.76