Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3YZA6

Protein Details
Accession A0A2T3YZA6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-49LTAHQYQKILPRRKRRHRDQHVSHKIVTHydrophilic
NLS Segment(s)
PositionSequence
33-38RRKRRH
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 8.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MHFVRQAFSLSSCLQLLQFSVLTAHQYQKILPRRKRRHRDQHVSHKIVTCHESCCPTTASCSQVQGGPKHSSRVTTTTNQLLVIPHARGHYYSLMVTQKPPYDRPPPQQHIATCCLIYGHRPKDPSVSLQASF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.12
5 0.12
6 0.09
7 0.1
8 0.1
9 0.13
10 0.14
11 0.16
12 0.17
13 0.17
14 0.19
15 0.27
16 0.36
17 0.44
18 0.5
19 0.59
20 0.67
21 0.78
22 0.87
23 0.89
24 0.91
25 0.92
26 0.94
27 0.93
28 0.94
29 0.93
30 0.86
31 0.78
32 0.7
33 0.6
34 0.52
35 0.44
36 0.34
37 0.25
38 0.23
39 0.24
40 0.2
41 0.21
42 0.19
43 0.16
44 0.19
45 0.19
46 0.2
47 0.17
48 0.18
49 0.17
50 0.18
51 0.21
52 0.19
53 0.21
54 0.22
55 0.22
56 0.24
57 0.23
58 0.23
59 0.22
60 0.25
61 0.25
62 0.24
63 0.26
64 0.26
65 0.26
66 0.24
67 0.23
68 0.18
69 0.16
70 0.15
71 0.13
72 0.12
73 0.12
74 0.12
75 0.12
76 0.14
77 0.14
78 0.13
79 0.12
80 0.15
81 0.18
82 0.18
83 0.19
84 0.2
85 0.23
86 0.25
87 0.28
88 0.3
89 0.37
90 0.43
91 0.51
92 0.59
93 0.61
94 0.63
95 0.66
96 0.63
97 0.59
98 0.57
99 0.49
100 0.38
101 0.32
102 0.27
103 0.22
104 0.26
105 0.3
106 0.31
107 0.34
108 0.36
109 0.37
110 0.43
111 0.46
112 0.44
113 0.43