Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZEW6

Protein Details
Accession A0A2T3ZEW6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
116-142AAEEEKKKEKEKDKEKEKPKANRVEEEAcidic
NLS Segment(s)
PositionSequence
120-136EKKKEKEKDKEKEKPKA
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MEPRARAGKNVGKMNFSYAELAQLLYAHGDIKNPMPETVRVLDEILTDFMQSIAFEANRAANYSGRQKIKYEDFEFAFRKNPSFLGKVQEVFEKQKEIKKAREILRDGEDEIMKDAAEEEKKKEKEKDKEKEKPKANRVEEELGEADDDAEAEADALGKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.36
4 0.3
5 0.22
6 0.22
7 0.19
8 0.19
9 0.14
10 0.12
11 0.11
12 0.08
13 0.08
14 0.07
15 0.07
16 0.08
17 0.09
18 0.12
19 0.17
20 0.18
21 0.19
22 0.2
23 0.21
24 0.24
25 0.25
26 0.23
27 0.19
28 0.18
29 0.17
30 0.15
31 0.15
32 0.13
33 0.1
34 0.09
35 0.08
36 0.08
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.08
45 0.08
46 0.1
47 0.1
48 0.1
49 0.13
50 0.19
51 0.25
52 0.26
53 0.27
54 0.27
55 0.31
56 0.35
57 0.4
58 0.35
59 0.33
60 0.31
61 0.35
62 0.35
63 0.31
64 0.3
65 0.23
66 0.22
67 0.19
68 0.19
69 0.17
70 0.18
71 0.19
72 0.19
73 0.2
74 0.21
75 0.21
76 0.22
77 0.21
78 0.22
79 0.21
80 0.21
81 0.21
82 0.24
83 0.31
84 0.33
85 0.37
86 0.4
87 0.48
88 0.5
89 0.57
90 0.55
91 0.51
92 0.51
93 0.46
94 0.4
95 0.35
96 0.28
97 0.2
98 0.19
99 0.15
100 0.11
101 0.09
102 0.09
103 0.1
104 0.14
105 0.16
106 0.19
107 0.29
108 0.32
109 0.38
110 0.46
111 0.52
112 0.58
113 0.67
114 0.73
115 0.74
116 0.82
117 0.86
118 0.88
119 0.87
120 0.87
121 0.86
122 0.86
123 0.81
124 0.78
125 0.74
126 0.71
127 0.61
128 0.55
129 0.46
130 0.36
131 0.31
132 0.24
133 0.17
134 0.11
135 0.1
136 0.06
137 0.05
138 0.05
139 0.04
140 0.04
141 0.06