Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3Z8X9

Protein Details
Accession A0A2T3Z8X9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MKTPAPRASRKPNGPPRRPSKKARARLTQCPRRAFHydrophilic
NLS Segment(s)
PositionSequence
6-26PRASRKPNGPPRRPSKKARAR
Subcellular Location(s) plas 12, mito 6, cyto 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MKTPAPRASRKPNGPPRRPSKKARARLTQCPRRAFSYVLIQSPPERGIFFPFSQVISLTQFLLLCQVFVIVFRKLPEPIVGRAVGIFAERNYLIRKVVGSNATM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.88
5 0.86
6 0.84
7 0.84
8 0.84
9 0.85
10 0.84
11 0.84
12 0.8
13 0.84
14 0.86
15 0.85
16 0.81
17 0.77
18 0.71
19 0.64
20 0.6
21 0.51
22 0.43
23 0.43
24 0.38
25 0.33
26 0.31
27 0.27
28 0.26
29 0.25
30 0.23
31 0.13
32 0.11
33 0.1
34 0.13
35 0.16
36 0.15
37 0.16
38 0.15
39 0.15
40 0.14
41 0.14
42 0.11
43 0.1
44 0.1
45 0.08
46 0.08
47 0.08
48 0.08
49 0.1
50 0.09
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.1
57 0.08
58 0.09
59 0.1
60 0.12
61 0.13
62 0.14
63 0.18
64 0.19
65 0.2
66 0.22
67 0.22
68 0.2
69 0.19
70 0.19
71 0.14
72 0.11
73 0.1
74 0.07
75 0.1
76 0.11
77 0.13
78 0.16
79 0.17
80 0.17
81 0.18
82 0.19
83 0.18
84 0.24