Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3YZZ2

Protein Details
Accession A0A2T3YZZ2   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
150-178QKDAEQQAANRKPKKKAKKIKLSFDEEEGHydrophilic
NLS Segment(s)
PositionSequence
159-170NRKPKKKAKKIK
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSQKINSKNLSYNSSLPPFLAALRAQASGASGPDPILSAQRRGGKKRSSSEEAEDAPLIVDEEGNTVGDLKVNKDGTVEELPNDSGNDGTKDGDAETTQSKTNKTEPETAKASIGGRKRKVGKVIGEDAENSEPETAAAHQKSEPVKKDQKDAEQQAANRKPKKKAKKIKLSFDEEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.34
4 0.31
5 0.26
6 0.23
7 0.21
8 0.14
9 0.14
10 0.15
11 0.16
12 0.14
13 0.13
14 0.14
15 0.12
16 0.12
17 0.1
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.13
24 0.14
25 0.16
26 0.21
27 0.29
28 0.34
29 0.39
30 0.47
31 0.48
32 0.54
33 0.6
34 0.63
35 0.61
36 0.59
37 0.58
38 0.55
39 0.49
40 0.43
41 0.35
42 0.27
43 0.21
44 0.17
45 0.12
46 0.07
47 0.06
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.07
56 0.07
57 0.08
58 0.13
59 0.13
60 0.13
61 0.13
62 0.13
63 0.15
64 0.17
65 0.16
66 0.12
67 0.12
68 0.13
69 0.13
70 0.12
71 0.08
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.07
81 0.06
82 0.07
83 0.08
84 0.09
85 0.11
86 0.12
87 0.13
88 0.15
89 0.2
90 0.23
91 0.26
92 0.33
93 0.33
94 0.37
95 0.39
96 0.38
97 0.34
98 0.3
99 0.28
100 0.24
101 0.29
102 0.32
103 0.31
104 0.37
105 0.42
106 0.45
107 0.49
108 0.5
109 0.49
110 0.47
111 0.51
112 0.45
113 0.4
114 0.37
115 0.34
116 0.29
117 0.23
118 0.17
119 0.12
120 0.1
121 0.09
122 0.1
123 0.09
124 0.14
125 0.14
126 0.15
127 0.16
128 0.21
129 0.27
130 0.33
131 0.36
132 0.39
133 0.47
134 0.49
135 0.57
136 0.58
137 0.61
138 0.64
139 0.65
140 0.64
141 0.6
142 0.61
143 0.63
144 0.66
145 0.66
146 0.64
147 0.66
148 0.68
149 0.74
150 0.82
151 0.82
152 0.85
153 0.87
154 0.9
155 0.93
156 0.94
157 0.92
158 0.9