Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZQD3

Protein Details
Accession A0A2T3ZQD3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31ARKAPAAGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
3-25RKAPAAGAKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MARKAPAAGAKKQKKKWSKGKVKDKAQHAVILDKTISEKLYKDVQSYRLVTVAVLVDRMKINGSLARQCIKDLEEKGMIKPVITHSKMKIYTRAIGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.86
4 0.86
5 0.87
6 0.89
7 0.92
8 0.92
9 0.92
10 0.89
11 0.85
12 0.81
13 0.72
14 0.64
15 0.54
16 0.49
17 0.39
18 0.33
19 0.26
20 0.18
21 0.18
22 0.15
23 0.14
24 0.1
25 0.1
26 0.11
27 0.18
28 0.18
29 0.2
30 0.22
31 0.24
32 0.28
33 0.29
34 0.26
35 0.2
36 0.19
37 0.17
38 0.15
39 0.12
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.07
47 0.07
48 0.08
49 0.1
50 0.12
51 0.15
52 0.17
53 0.21
54 0.2
55 0.21
56 0.21
57 0.2
58 0.24
59 0.22
60 0.24
61 0.27
62 0.28
63 0.28
64 0.33
65 0.32
66 0.25
67 0.26
68 0.28
69 0.32
70 0.34
71 0.37
72 0.34
73 0.43
74 0.48
75 0.5
76 0.5
77 0.45