Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3YWR5

Protein Details
Accession A0A2T3YWR5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-103EGQGARRRRSTLRKLKQQVRRSREIRBasic
NLS Segment(s)
PositionSequence
82-99ARRRRSTLRKLKQQVRRS
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences VRTSSIPESFSTAEDDREGDSGVMDRDVLRGLHIAASAACDEEVDTFVRNKTGLRLRRFLADLMVLETLRDVRPEEGEGQGARRRRSTLRKLKQQVRRSREIRELGMAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.17
4 0.16
5 0.16
6 0.1
7 0.1
8 0.1
9 0.1
10 0.09
11 0.08
12 0.07
13 0.07
14 0.09
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.06
23 0.08
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.13
39 0.2
40 0.27
41 0.3
42 0.33
43 0.33
44 0.36
45 0.37
46 0.31
47 0.24
48 0.18
49 0.14
50 0.12
51 0.12
52 0.09
53 0.08
54 0.08
55 0.08
56 0.07
57 0.08
58 0.08
59 0.08
60 0.09
61 0.11
62 0.13
63 0.12
64 0.14
65 0.14
66 0.17
67 0.2
68 0.24
69 0.25
70 0.25
71 0.28
72 0.34
73 0.44
74 0.52
75 0.59
76 0.65
77 0.74
78 0.82
79 0.87
80 0.89
81 0.89
82 0.89
83 0.86
84 0.86
85 0.78
86 0.76
87 0.75
88 0.71
89 0.64