Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3YVY7

Protein Details
Accession A0A2T3YVY7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-67IFSLPTNAKKKKKKKSVEAIPGQLHydrophilic
NLS Segment(s)
PositionSequence
52-58KKKKKKK
Subcellular Location(s) nucl 7.5, cyto_nucl 6.5, mito 5, cyto 4.5, pero 3, plas 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGVVALQFSLESNPPFESRCPSPRFFPMPQLADFVLCFLSSFLIFSLPTNAKKKKKKKSVEAIPGQLTGRPRYTTLPSYPYRTRLGSSYLTRHRKLSRGGPQFVRQCELLEGKYPKKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.23
5 0.27
6 0.35
7 0.39
8 0.4
9 0.43
10 0.49
11 0.54
12 0.5
13 0.51
14 0.5
15 0.48
16 0.46
17 0.44
18 0.37
19 0.3
20 0.28
21 0.21
22 0.13
23 0.09
24 0.09
25 0.06
26 0.06
27 0.05
28 0.06
29 0.05
30 0.06
31 0.06
32 0.06
33 0.11
34 0.13
35 0.18
36 0.25
37 0.32
38 0.4
39 0.5
40 0.6
41 0.66
42 0.74
43 0.78
44 0.81
45 0.85
46 0.86
47 0.86
48 0.81
49 0.75
50 0.66
51 0.58
52 0.48
53 0.39
54 0.3
55 0.23
56 0.19
57 0.16
58 0.16
59 0.18
60 0.22
61 0.24
62 0.25
63 0.29
64 0.3
65 0.36
66 0.37
67 0.38
68 0.37
69 0.34
70 0.33
71 0.28
72 0.3
73 0.3
74 0.31
75 0.36
76 0.42
77 0.48
78 0.49
79 0.53
80 0.52
81 0.52
82 0.54
83 0.56
84 0.56
85 0.58
86 0.63
87 0.63
88 0.67
89 0.68
90 0.64
91 0.58
92 0.48
93 0.4
94 0.38
95 0.36
96 0.29
97 0.31
98 0.35
99 0.41