Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZF01

Protein Details
Accession A0A2T3ZF01    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-100EELKQRGKSAPKKKTGPPGTBasic
NLS Segment(s)
PositionSequence
86-96RGKSAPKKKTG
Subcellular Location(s) mito 17.5, cyto_mito 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRARLLDLMKAQCQVFATTFNPEGVRMGNKVLRQRLKGPALAAYYPRKLASIKDVKREFGPVLATWDEAEEDRFEYIEELKQRGKSAPKKKTGPPGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.32
4 0.25
5 0.19
6 0.18
7 0.18
8 0.19
9 0.2
10 0.2
11 0.19
12 0.17
13 0.17
14 0.15
15 0.16
16 0.13
17 0.15
18 0.17
19 0.2
20 0.25
21 0.33
22 0.36
23 0.37
24 0.4
25 0.45
26 0.44
27 0.43
28 0.38
29 0.33
30 0.3
31 0.28
32 0.27
33 0.23
34 0.21
35 0.2
36 0.19
37 0.16
38 0.15
39 0.15
40 0.2
41 0.27
42 0.3
43 0.38
44 0.39
45 0.4
46 0.4
47 0.42
48 0.33
49 0.24
50 0.23
51 0.14
52 0.17
53 0.16
54 0.16
55 0.13
56 0.13
57 0.12
58 0.1
59 0.11
60 0.08
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.1
67 0.14
68 0.16
69 0.19
70 0.22
71 0.25
72 0.27
73 0.31
74 0.4
75 0.45
76 0.53
77 0.6
78 0.66
79 0.71
80 0.76