Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3Z2I2

Protein Details
Accession A0A2T3Z2I2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
60-81GSEKQRDGPKPKREIPRHFSRSBasic
NLS Segment(s)
PositionSequence
63-75KQRDGPKPKREIP
Subcellular Location(s) nucl 13, mito 9, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MTPLWGNVTPPFSVFDLIHLLPTRYQYLGFAFIQQHTPNRGRPTASPEPLGSRSKVEAPGSEKQRDGPKPKREIPRHFSRSSRPCLGEYLIHKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.18
4 0.18
5 0.2
6 0.19
7 0.19
8 0.17
9 0.2
10 0.2
11 0.15
12 0.15
13 0.13
14 0.14
15 0.17
16 0.16
17 0.16
18 0.16
19 0.16
20 0.19
21 0.19
22 0.2
23 0.21
24 0.23
25 0.25
26 0.28
27 0.29
28 0.28
29 0.28
30 0.34
31 0.37
32 0.36
33 0.33
34 0.3
35 0.32
36 0.34
37 0.34
38 0.26
39 0.2
40 0.19
41 0.2
42 0.23
43 0.2
44 0.19
45 0.22
46 0.29
47 0.33
48 0.34
49 0.32
50 0.32
51 0.4
52 0.45
53 0.49
54 0.51
55 0.55
56 0.62
57 0.7
58 0.77
59 0.78
60 0.8
61 0.79
62 0.81
63 0.79
64 0.75
65 0.72
66 0.72
67 0.71
68 0.69
69 0.68
70 0.6
71 0.54
72 0.53
73 0.51
74 0.47