Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3YWZ4

Protein Details
Accession A0A2T3YWZ4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-56AKKAYRTSKGAPKPSRERKAKVTKKASPKKANKGENDKNTRPHydrophilic
NLS Segment(s)
PositionSequence
16-48KKAYRTSKGAPKPSRERKAKVTKKASPKKANKG
Subcellular Location(s) mito 12.5, mito_nucl 11.333, nucl 9, cyto_nucl 7.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016209  F:antioxidant activity  
GO:0016491  F:oxidoreductase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
Amino Acid Sequences MPVTRAAANGNTSTAKKAYRTSKGAPKPSRERKAKVTKKASPKKANKGENDKNTRPHLSIGSKVPLCDNFGGELYLHDGTETSLKQLVDKSRNGVIVYVFPKRWDGDAYDMYSEFNHAQLDWEPAEMDTIGISPDSVPSTAAFVKEKDISLPLASNPSASLIKAMSITSSKGKMTQGAFIISKTGLLLARTMGKQDKIMDDLDKIIFTLIEGKRQEIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.32
5 0.38
6 0.44
7 0.5
8 0.54
9 0.62
10 0.68
11 0.76
12 0.76
13 0.76
14 0.79
15 0.83
16 0.85
17 0.83
18 0.8
19 0.8
20 0.84
21 0.84
22 0.84
23 0.83
24 0.81
25 0.84
26 0.88
27 0.88
28 0.88
29 0.88
30 0.88
31 0.88
32 0.88
33 0.86
34 0.86
35 0.85
36 0.84
37 0.84
38 0.78
39 0.74
40 0.72
41 0.66
42 0.56
43 0.49
44 0.45
45 0.39
46 0.38
47 0.36
48 0.37
49 0.34
50 0.33
51 0.33
52 0.27
53 0.27
54 0.23
55 0.2
56 0.14
57 0.14
58 0.14
59 0.12
60 0.11
61 0.1
62 0.1
63 0.09
64 0.08
65 0.07
66 0.07
67 0.1
68 0.1
69 0.08
70 0.11
71 0.11
72 0.12
73 0.16
74 0.22
75 0.24
76 0.25
77 0.27
78 0.26
79 0.28
80 0.27
81 0.24
82 0.18
83 0.18
84 0.19
85 0.19
86 0.17
87 0.16
88 0.17
89 0.17
90 0.17
91 0.14
92 0.13
93 0.14
94 0.16
95 0.17
96 0.16
97 0.16
98 0.15
99 0.14
100 0.13
101 0.09
102 0.07
103 0.06
104 0.06
105 0.07
106 0.08
107 0.1
108 0.09
109 0.09
110 0.08
111 0.08
112 0.09
113 0.07
114 0.06
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.03
121 0.04
122 0.05
123 0.05
124 0.05
125 0.06
126 0.08
127 0.09
128 0.11
129 0.11
130 0.11
131 0.14
132 0.15
133 0.15
134 0.13
135 0.14
136 0.13
137 0.13
138 0.14
139 0.11
140 0.13
141 0.13
142 0.12
143 0.11
144 0.13
145 0.12
146 0.11
147 0.12
148 0.09
149 0.09
150 0.1
151 0.1
152 0.09
153 0.09
154 0.11
155 0.14
156 0.16
157 0.16
158 0.18
159 0.19
160 0.23
161 0.23
162 0.25
163 0.23
164 0.25
165 0.25
166 0.22
167 0.23
168 0.18
169 0.17
170 0.12
171 0.12
172 0.1
173 0.1
174 0.1
175 0.1
176 0.15
177 0.16
178 0.19
179 0.22
180 0.22
181 0.25
182 0.27
183 0.29
184 0.26
185 0.28
186 0.26
187 0.24
188 0.25
189 0.23
190 0.2
191 0.17
192 0.15
193 0.12
194 0.11
195 0.18
196 0.16
197 0.23
198 0.24