Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AIB2

Protein Details
Accession G3AIB2    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
131-156DAIILEKRPRYKRQLEKQQQKKKTWFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 13, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG spaa:SPAPADRAFT_134611  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSLTPQQAFKKLPAKLHNFFLRYPPRPYAQYAAGKSTIDDPQRNPFFPNKNTTNGRWYDATYSRRRSADLFKTAYKFGLQDLLPPMPRKFYQDKFDNKNWMRGVLHQKKQKWERELPAKLEARKEAIENMDAIILEKRPRYKRQLEKQQQKKKTWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.63
4 0.64
5 0.58
6 0.55
7 0.57
8 0.57
9 0.53
10 0.55
11 0.5
12 0.47
13 0.47
14 0.5
15 0.45
16 0.43
17 0.46
18 0.43
19 0.42
20 0.39
21 0.37
22 0.33
23 0.32
24 0.3
25 0.26
26 0.27
27 0.26
28 0.34
29 0.38
30 0.38
31 0.37
32 0.39
33 0.41
34 0.42
35 0.48
36 0.42
37 0.45
38 0.49
39 0.48
40 0.48
41 0.43
42 0.42
43 0.35
44 0.32
45 0.3
46 0.33
47 0.37
48 0.37
49 0.4
50 0.41
51 0.41
52 0.41
53 0.38
54 0.4
55 0.41
56 0.4
57 0.38
58 0.36
59 0.38
60 0.37
61 0.34
62 0.26
63 0.19
64 0.13
65 0.15
66 0.12
67 0.12
68 0.14
69 0.16
70 0.17
71 0.19
72 0.19
73 0.17
74 0.18
75 0.21
76 0.25
77 0.29
78 0.34
79 0.41
80 0.49
81 0.53
82 0.57
83 0.62
84 0.57
85 0.59
86 0.52
87 0.47
88 0.4
89 0.4
90 0.46
91 0.46
92 0.52
93 0.52
94 0.55
95 0.62
96 0.7
97 0.71
98 0.68
99 0.66
100 0.68
101 0.71
102 0.73
103 0.67
104 0.67
105 0.64
106 0.59
107 0.56
108 0.48
109 0.41
110 0.36
111 0.34
112 0.28
113 0.25
114 0.23
115 0.19
116 0.18
117 0.15
118 0.14
119 0.14
120 0.12
121 0.12
122 0.14
123 0.18
124 0.26
125 0.33
126 0.41
127 0.49
128 0.58
129 0.66
130 0.75
131 0.82
132 0.85
133 0.89
134 0.92
135 0.94
136 0.93