Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZNE3

Protein Details
Accession A0A2T3ZNE3   
Localization Confidence High
Confidence Score 23.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-63DARSNFTGSGRKRRKRPGENDTEFELHydrophilic
210-240EELRQLRKESHRDRHRDRHSERERRERRGYSBasic
242-301AQRHESRRARSKERDTDSRGRHDDHRERRRHKEEERRKRHRDSRSCSPDWRGHRHRHDERBasic
NLS Segment(s)
PositionSequence
47-54GRKRRKRP
196-285ELKKERRKIQEERDEELRQLRKESHRDRHRDRHSERERRERRGYSDAQRHESRRARSKERDTDSRGRHDDHRERRRHKEEERRKRHRDSR
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039875  LENG1-like  
Amino Acid Sequences MQEVDAQRRLAILRGEAPPPLEDECEAESEKARDTSGDARSNFTGSGRKRRKRPGENDTEFELRLAKERNNAAYAVVESGRKLASSAPIVDHAGHIDLFGDERARAHAEKNQEAEAERKKKEREYEDQYTMRFSNAAGKDGISQPWYSHGEGVAPDVSAKNVWGQNDPDRKTRDTQRINSNDPLAMMKKGAMQVRELKKERRKIQEERDEELRQLRKESHRDRHRDRHSERERRERRGYSDAQRHESRRARSKERDTDSRGRHDDHRERRRHKEEERRKRHRDSRSCSPDWRGHRHRHDER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.27
4 0.28
5 0.24
6 0.25
7 0.23
8 0.19
9 0.16
10 0.18
11 0.18
12 0.19
13 0.2
14 0.18
15 0.19
16 0.19
17 0.22
18 0.2
19 0.18
20 0.16
21 0.18
22 0.24
23 0.29
24 0.35
25 0.33
26 0.36
27 0.37
28 0.38
29 0.34
30 0.29
31 0.3
32 0.29
33 0.39
34 0.46
35 0.53
36 0.61
37 0.72
38 0.81
39 0.83
40 0.88
41 0.87
42 0.88
43 0.85
44 0.8
45 0.75
46 0.66
47 0.55
48 0.45
49 0.37
50 0.26
51 0.24
52 0.24
53 0.21
54 0.24
55 0.28
56 0.3
57 0.3
58 0.3
59 0.25
60 0.23
61 0.21
62 0.17
63 0.15
64 0.12
65 0.1
66 0.12
67 0.11
68 0.1
69 0.09
70 0.09
71 0.11
72 0.13
73 0.14
74 0.14
75 0.16
76 0.17
77 0.17
78 0.15
79 0.12
80 0.11
81 0.09
82 0.08
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.05
89 0.06
90 0.08
91 0.1
92 0.1
93 0.12
94 0.15
95 0.2
96 0.24
97 0.25
98 0.25
99 0.23
100 0.23
101 0.27
102 0.33
103 0.34
104 0.33
105 0.36
106 0.38
107 0.42
108 0.48
109 0.49
110 0.49
111 0.51
112 0.55
113 0.57
114 0.56
115 0.52
116 0.47
117 0.41
118 0.32
119 0.23
120 0.16
121 0.18
122 0.17
123 0.18
124 0.15
125 0.15
126 0.17
127 0.18
128 0.19
129 0.11
130 0.11
131 0.09
132 0.13
133 0.16
134 0.14
135 0.13
136 0.12
137 0.12
138 0.12
139 0.13
140 0.09
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.06
147 0.08
148 0.09
149 0.1
150 0.12
151 0.15
152 0.22
153 0.3
154 0.33
155 0.35
156 0.37
157 0.38
158 0.41
159 0.47
160 0.49
161 0.5
162 0.53
163 0.58
164 0.6
165 0.62
166 0.6
167 0.53
168 0.43
169 0.36
170 0.32
171 0.23
172 0.17
173 0.13
174 0.11
175 0.12
176 0.15
177 0.17
178 0.16
179 0.17
180 0.26
181 0.32
182 0.4
183 0.42
184 0.48
185 0.54
186 0.62
187 0.68
188 0.69
189 0.7
190 0.71
191 0.77
192 0.78
193 0.75
194 0.7
195 0.69
196 0.6
197 0.53
198 0.51
199 0.46
200 0.37
201 0.35
202 0.37
203 0.38
204 0.47
205 0.55
206 0.58
207 0.63
208 0.71
209 0.78
210 0.83
211 0.85
212 0.85
213 0.81
214 0.81
215 0.82
216 0.83
217 0.82
218 0.83
219 0.81
220 0.79
221 0.83
222 0.77
223 0.73
224 0.71
225 0.7
226 0.69
227 0.71
228 0.68
229 0.66
230 0.67
231 0.64
232 0.65
233 0.65
234 0.63
235 0.64
236 0.66
237 0.68
238 0.72
239 0.79
240 0.79
241 0.8
242 0.81
243 0.79
244 0.8
245 0.78
246 0.77
247 0.71
248 0.65
249 0.64
250 0.66
251 0.68
252 0.69
253 0.73
254 0.74
255 0.77
256 0.84
257 0.86
258 0.85
259 0.85
260 0.86
261 0.87
262 0.87
263 0.91
264 0.91
265 0.91
266 0.92
267 0.91
268 0.9
269 0.9
270 0.87
271 0.87
272 0.86
273 0.83
274 0.79
275 0.77
276 0.74
277 0.72
278 0.74
279 0.72
280 0.73
281 0.78