Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3Z9D9

Protein Details
Accession A0A2T3Z9D9   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-49VDGLGRETKRRCRKRPWPRSCATRANAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences LPPRPSRLLPQNSRGHRDVRSYVDGLGRETKRRCRKRPWPRSCATRANAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.51
4 0.5
5 0.44
6 0.4
7 0.38
8 0.32
9 0.31
10 0.3
11 0.27
12 0.24
13 0.27
14 0.23
15 0.25
16 0.29
17 0.38
18 0.46
19 0.56
20 0.62
21 0.66
22 0.76
23 0.81
24 0.89
25 0.9
26 0.89
27 0.87
28 0.89
29 0.86
30 0.85