Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3YT34

Protein Details
Accession A0A2T3YT34    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-101RASITPKKSLKQQKGKRLQAATHydrophilic
NLS Segment(s)
PositionSequence
86-96KKSLKQQKGKR
Subcellular Location(s) extr 20, E.R. 4, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTDGLWPVLFLITISACIGILACLTFTVFSIIFERQAVDGETQRRHVVEDDSPVESYCTLERSFNGPFDDNASVNGQRRASITPKKSLKQQKGKRLQAATVRRDFRLSQSGKQVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.06
6 0.06
7 0.05
8 0.05
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.05
15 0.07
16 0.07
17 0.07
18 0.1
19 0.1
20 0.11
21 0.11
22 0.12
23 0.09
24 0.1
25 0.11
26 0.1
27 0.13
28 0.17
29 0.18
30 0.2
31 0.2
32 0.19
33 0.19
34 0.19
35 0.18
36 0.15
37 0.18
38 0.18
39 0.18
40 0.19
41 0.17
42 0.16
43 0.13
44 0.12
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.12
51 0.13
52 0.14
53 0.16
54 0.15
55 0.14
56 0.17
57 0.18
58 0.15
59 0.16
60 0.16
61 0.16
62 0.18
63 0.21
64 0.18
65 0.17
66 0.18
67 0.2
68 0.25
69 0.32
70 0.34
71 0.4
72 0.47
73 0.49
74 0.57
75 0.64
76 0.67
77 0.7
78 0.75
79 0.77
80 0.81
81 0.87
82 0.85
83 0.78
84 0.74
85 0.72
86 0.72
87 0.7
88 0.67
89 0.62
90 0.55
91 0.55
92 0.51
93 0.47
94 0.48
95 0.44
96 0.41
97 0.49