Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZB14

Protein Details
Accession A0A2T3ZB14    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-71TGISNTKAKRKGKKAKPWPIKGSTNSHydrophilic
NLS Segment(s)
PositionSequence
52-64KAKRKGKKAKPWP
Subcellular Location(s) extr 8, E.R. 4, nucl 3.5, cyto_nucl 3.5, mito 3, plas 3, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPCYLLGGIVIVVYRFLFISLFFPNRERLGVTRLQPQANATNSRHTGISNTKAKRKGKKAKPWPIKGSTNSNNYCRLIKQLHIKDCCRYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.08
7 0.12
8 0.14
9 0.15
10 0.16
11 0.19
12 0.2
13 0.2
14 0.19
15 0.17
16 0.19
17 0.23
18 0.24
19 0.29
20 0.32
21 0.31
22 0.3
23 0.31
24 0.32
25 0.3
26 0.33
27 0.26
28 0.27
29 0.28
30 0.28
31 0.26
32 0.21
33 0.21
34 0.2
35 0.26
36 0.29
37 0.31
38 0.37
39 0.44
40 0.51
41 0.57
42 0.64
43 0.67
44 0.7
45 0.78
46 0.83
47 0.86
48 0.9
49 0.9
50 0.87
51 0.84
52 0.81
53 0.74
54 0.73
55 0.69
56 0.68
57 0.63
58 0.58
59 0.56
60 0.51
61 0.49
62 0.4
63 0.4
64 0.34
65 0.35
66 0.43
67 0.47
68 0.54
69 0.59
70 0.62