Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZQ66

Protein Details
Accession A0A2T3ZQ66   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-41RFCPSCCLHTRKEKKKENNKKEKQRVPTIFNHydrophilic
NLS Segment(s)
PositionSequence
21-34RKEKKKENNKKEKQ
Subcellular Location(s) mito 24, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MFRQLYSGSLRFCPSCCLHTRKEKKKENNKKEKQRVPTIFNRPGVSTAQEHTHSWIPKAQGKRLLGRSTSVSAKRALLEHLGELYSGTSGIAGLSLIPPSRGPWVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.33
4 0.37
5 0.41
6 0.51
7 0.61
8 0.66
9 0.74
10 0.79
11 0.83
12 0.89
13 0.93
14 0.93
15 0.94
16 0.94
17 0.94
18 0.95
19 0.92
20 0.89
21 0.88
22 0.83
23 0.78
24 0.76
25 0.74
26 0.7
27 0.65
28 0.58
29 0.48
30 0.43
31 0.38
32 0.3
33 0.22
34 0.17
35 0.17
36 0.17
37 0.17
38 0.17
39 0.21
40 0.19
41 0.18
42 0.2
43 0.19
44 0.23
45 0.26
46 0.27
47 0.29
48 0.31
49 0.37
50 0.4
51 0.41
52 0.37
53 0.35
54 0.35
55 0.31
56 0.34
57 0.3
58 0.26
59 0.24
60 0.24
61 0.24
62 0.22
63 0.2
64 0.17
65 0.16
66 0.15
67 0.14
68 0.13
69 0.12
70 0.11
71 0.1
72 0.07
73 0.06
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.04
81 0.04
82 0.06
83 0.07
84 0.08
85 0.09
86 0.11