Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZAX0

Protein Details
Accession A0A2T3ZAX0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-28NNKLDFRKLKPFKILKKIRKVNYKLNLHydrophilic
NLS Segment(s)
PositionSequence
14-18KILKK
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences LNNKLDFRKLKPFKILKKIRKVNYKLNLPNNIKLKTAVFYILLLEKALVNKETGKPIIDKIIIQDKEEEYKINKITCM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.79
4 0.83
5 0.87
6 0.85
7 0.86
8 0.82
9 0.81
10 0.8
11 0.79
12 0.76
13 0.74
14 0.75
15 0.69
16 0.69
17 0.65
18 0.57
19 0.48
20 0.41
21 0.34
22 0.26
23 0.23
24 0.17
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.07
31 0.07
32 0.06
33 0.07
34 0.08
35 0.07
36 0.07
37 0.1
38 0.12
39 0.16
40 0.16
41 0.17
42 0.17
43 0.19
44 0.23
45 0.21
46 0.19
47 0.2
48 0.29
49 0.28
50 0.28
51 0.3
52 0.27
53 0.31
54 0.32
55 0.31
56 0.24
57 0.3
58 0.34