Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZFL7

Protein Details
Accession A0A2T3ZFL7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-71ITPQMAAEKKKKKERIERMVQHydrophilic
NLS Segment(s)
PositionSequence
59-65KKKKKER
Subcellular Location(s) nucl 9, cyto 8.5, cyto_mito 8, mito 6.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQAREEATAIVMRKFAGSETGYFRSILLLFCFFSHWVCHKNQTAALGNFGITPQMAAEKKKKKERIERMVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.14
6 0.19
7 0.22
8 0.22
9 0.22
10 0.22
11 0.19
12 0.18
13 0.16
14 0.12
15 0.1
16 0.1
17 0.1
18 0.11
19 0.1
20 0.1
21 0.11
22 0.11
23 0.14
24 0.14
25 0.19
26 0.2
27 0.22
28 0.22
29 0.25
30 0.29
31 0.26
32 0.27
33 0.22
34 0.2
35 0.18
36 0.17
37 0.13
38 0.07
39 0.06
40 0.04
41 0.1
42 0.12
43 0.17
44 0.27
45 0.36
46 0.45
47 0.56
48 0.64
49 0.69
50 0.78
51 0.85