Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3Z2G0

Protein Details
Accession A0A2T3Z2G0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-62VPPQTGPRKRGRPRKSLVDPYHydrophilic
NLS Segment(s)
PositionSequence
48-56PRKRGRPRK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRQIDSKKSRGLASYQEQQADPKQRHSLPLMGVPPGAPTPGVPPQTGPRKRGRPRKSLVDPYGNVMTTNKGPQARSQTTEQPITPALAYKTGYGNGNEVLSGEARRQQTREHYEQYIAYRGRAPPIQAQAQAQTGFEYVSRLTSEAQVRVALDYVAHAQGNVSMKERHIAALFHRLEQVRIQSGISQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.46
4 0.44
5 0.44
6 0.47
7 0.48
8 0.44
9 0.41
10 0.45
11 0.44
12 0.48
13 0.48
14 0.45
15 0.38
16 0.42
17 0.38
18 0.31
19 0.3
20 0.25
21 0.23
22 0.19
23 0.16
24 0.09
25 0.08
26 0.12
27 0.18
28 0.2
29 0.19
30 0.21
31 0.28
32 0.39
33 0.44
34 0.44
35 0.48
36 0.56
37 0.66
38 0.74
39 0.75
40 0.74
41 0.76
42 0.81
43 0.81
44 0.8
45 0.77
46 0.74
47 0.66
48 0.6
49 0.55
50 0.45
51 0.36
52 0.26
53 0.22
54 0.16
55 0.17
56 0.16
57 0.16
58 0.17
59 0.21
60 0.29
61 0.3
62 0.31
63 0.33
64 0.36
65 0.37
66 0.39
67 0.35
68 0.27
69 0.25
70 0.22
71 0.19
72 0.14
73 0.11
74 0.1
75 0.11
76 0.1
77 0.1
78 0.11
79 0.12
80 0.11
81 0.12
82 0.1
83 0.1
84 0.08
85 0.08
86 0.07
87 0.06
88 0.06
89 0.06
90 0.1
91 0.13
92 0.14
93 0.15
94 0.17
95 0.25
96 0.32
97 0.37
98 0.36
99 0.36
100 0.36
101 0.37
102 0.37
103 0.35
104 0.28
105 0.23
106 0.23
107 0.22
108 0.23
109 0.23
110 0.23
111 0.21
112 0.26
113 0.28
114 0.26
115 0.27
116 0.25
117 0.27
118 0.25
119 0.2
120 0.16
121 0.13
122 0.12
123 0.1
124 0.1
125 0.07
126 0.08
127 0.09
128 0.09
129 0.09
130 0.14
131 0.17
132 0.17
133 0.18
134 0.18
135 0.17
136 0.17
137 0.17
138 0.12
139 0.09
140 0.09
141 0.1
142 0.1
143 0.1
144 0.09
145 0.09
146 0.13
147 0.16
148 0.16
149 0.17
150 0.17
151 0.18
152 0.21
153 0.21
154 0.2
155 0.18
156 0.18
157 0.19
158 0.28
159 0.28
160 0.27
161 0.32
162 0.3
163 0.3
164 0.33
165 0.35
166 0.29
167 0.28
168 0.28