Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZJA6

Protein Details
Accession A0A2T3ZJA6   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-35RKTPWSRTGCSTCKRRRKKCEFYAHLCQTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPRRVRKTPWSRTGCSTCKRRRKKCEFYAHLCQTCLRLGLECVQFDIFCPINVVTPTRDSRPTRAVTDGEDQDEASHSSPSSSGSADDAGGSSDAAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.73
3 0.73
4 0.72
5 0.76
6 0.82
7 0.85
8 0.87
9 0.9
10 0.92
11 0.92
12 0.93
13 0.9
14 0.87
15 0.87
16 0.84
17 0.75
18 0.65
19 0.55
20 0.45
21 0.37
22 0.31
23 0.2
24 0.12
25 0.11
26 0.16
27 0.18
28 0.16
29 0.16
30 0.15
31 0.14
32 0.14
33 0.16
34 0.1
35 0.08
36 0.1
37 0.09
38 0.1
39 0.11
40 0.12
41 0.09
42 0.13
43 0.15
44 0.16
45 0.23
46 0.24
47 0.28
48 0.33
49 0.35
50 0.34
51 0.35
52 0.34
53 0.3
54 0.34
55 0.31
56 0.27
57 0.24
58 0.21
59 0.18
60 0.19
61 0.17
62 0.11
63 0.11
64 0.09
65 0.09
66 0.09
67 0.11
68 0.11
69 0.11
70 0.1
71 0.11
72 0.12
73 0.12
74 0.12
75 0.1
76 0.09
77 0.09
78 0.08