Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AEG6

Protein Details
Accession G3AEG6    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MFRQVKRRTAGRRNFEDDKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016558  DNA_primase_lsu_euk  
IPR007238  DNA_primase_lsu_euk/arc  
Gene Ontology GO:0005658  C:alpha DNA polymerase:primase complex  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0006269  P:DNA replication, synthesis of RNA primer  
KEGG spaa:SPAPADRAFT_131134  -  
Pfam View protein in Pfam  
PF04104  DNA_primase_lrg  
CDD cd07322  PriL_PriS_Eukaryotic  
Amino Acid Sequences MFRQVKRRTAGRRNFEDDKFSSSVSPSSRLYKSRLSFYDIPPMSEITLEQFEMWAIDRLKILIEIESCQARSKSLKEIETSIKPLLLKYLPLSPSGENIEQERIKDHYSHYILRLVFCRSEDLRKKFIKNETTLFKVRYNLLQPKEQQEFIELYNDRLSWNYISANEKQEVFDQLYAACGLTIKNHLLVEGENLNNEQLRQHLLVKENFIKLPFEKCANLVGSRSIFLRNGYGYLPSSLQLNLLAIEFQENLNQILLQTFHTIPRLEEDDRILPLLNNMSRNFANIQYDSGYNQDPALASDINAQSVTTDTITQHYPLCAKHLQNTLVANSHLKYNARQQLGLFLKGIGLSVDEAVKFWSYQFTKSGVMSQEKFNKEYKYNIRHQYGLEGARINYKPWDCAIIYSKPNPGRGEAHGCPYRDFSLDSLVNNLQEMGITDQQELNNVIDDVNKRDYTIACTRVFELTHKKQLATAGAKMEGLHINHPNLYFDRSRQLAKSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.72
4 0.63
5 0.6
6 0.51
7 0.44
8 0.37
9 0.31
10 0.33
11 0.29
12 0.31
13 0.27
14 0.32
15 0.36
16 0.38
17 0.42
18 0.46
19 0.47
20 0.52
21 0.52
22 0.53
23 0.54
24 0.54
25 0.59
26 0.5
27 0.48
28 0.41
29 0.39
30 0.31
31 0.25
32 0.22
33 0.15
34 0.17
35 0.15
36 0.13
37 0.12
38 0.12
39 0.12
40 0.13
41 0.15
42 0.14
43 0.15
44 0.16
45 0.16
46 0.16
47 0.17
48 0.16
49 0.13
50 0.13
51 0.14
52 0.16
53 0.19
54 0.19
55 0.21
56 0.21
57 0.21
58 0.24
59 0.25
60 0.32
61 0.36
62 0.39
63 0.37
64 0.43
65 0.46
66 0.47
67 0.48
68 0.39
69 0.35
70 0.32
71 0.3
72 0.29
73 0.24
74 0.21
75 0.19
76 0.25
77 0.24
78 0.25
79 0.28
80 0.23
81 0.25
82 0.28
83 0.28
84 0.22
85 0.23
86 0.28
87 0.26
88 0.26
89 0.25
90 0.23
91 0.23
92 0.24
93 0.24
94 0.26
95 0.3
96 0.32
97 0.32
98 0.35
99 0.34
100 0.34
101 0.35
102 0.29
103 0.26
104 0.24
105 0.27
106 0.23
107 0.33
108 0.4
109 0.43
110 0.49
111 0.53
112 0.57
113 0.59
114 0.65
115 0.63
116 0.58
117 0.59
118 0.56
119 0.56
120 0.56
121 0.52
122 0.46
123 0.4
124 0.37
125 0.35
126 0.38
127 0.4
128 0.39
129 0.42
130 0.43
131 0.47
132 0.49
133 0.44
134 0.37
135 0.31
136 0.3
137 0.24
138 0.29
139 0.22
140 0.2
141 0.21
142 0.2
143 0.18
144 0.17
145 0.18
146 0.11
147 0.13
148 0.12
149 0.13
150 0.17
151 0.2
152 0.23
153 0.22
154 0.22
155 0.22
156 0.22
157 0.22
158 0.2
159 0.17
160 0.14
161 0.12
162 0.12
163 0.11
164 0.1
165 0.07
166 0.06
167 0.05
168 0.06
169 0.09
170 0.08
171 0.1
172 0.1
173 0.1
174 0.11
175 0.11
176 0.12
177 0.13
178 0.12
179 0.11
180 0.11
181 0.11
182 0.11
183 0.11
184 0.08
185 0.06
186 0.09
187 0.1
188 0.12
189 0.15
190 0.2
191 0.21
192 0.25
193 0.28
194 0.27
195 0.26
196 0.24
197 0.23
198 0.2
199 0.22
200 0.19
201 0.18
202 0.17
203 0.16
204 0.19
205 0.19
206 0.18
207 0.15
208 0.16
209 0.14
210 0.14
211 0.14
212 0.12
213 0.11
214 0.11
215 0.12
216 0.1
217 0.1
218 0.1
219 0.11
220 0.1
221 0.1
222 0.1
223 0.09
224 0.09
225 0.08
226 0.08
227 0.07
228 0.06
229 0.06
230 0.05
231 0.05
232 0.04
233 0.05
234 0.05
235 0.05
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.05
242 0.06
243 0.06
244 0.06
245 0.08
246 0.08
247 0.09
248 0.11
249 0.11
250 0.11
251 0.13
252 0.16
253 0.14
254 0.15
255 0.16
256 0.16
257 0.16
258 0.16
259 0.14
260 0.1
261 0.1
262 0.13
263 0.12
264 0.14
265 0.14
266 0.16
267 0.16
268 0.18
269 0.18
270 0.16
271 0.18
272 0.15
273 0.15
274 0.14
275 0.14
276 0.13
277 0.14
278 0.13
279 0.1
280 0.1
281 0.1
282 0.08
283 0.08
284 0.1
285 0.08
286 0.08
287 0.13
288 0.13
289 0.13
290 0.13
291 0.12
292 0.09
293 0.1
294 0.11
295 0.06
296 0.07
297 0.07
298 0.09
299 0.1
300 0.11
301 0.11
302 0.11
303 0.13
304 0.12
305 0.17
306 0.2
307 0.2
308 0.25
309 0.3
310 0.3
311 0.31
312 0.32
313 0.29
314 0.26
315 0.26
316 0.21
317 0.16
318 0.17
319 0.16
320 0.16
321 0.17
322 0.24
323 0.31
324 0.3
325 0.31
326 0.29
327 0.36
328 0.37
329 0.36
330 0.28
331 0.2
332 0.19
333 0.18
334 0.18
335 0.09
336 0.06
337 0.05
338 0.06
339 0.07
340 0.06
341 0.06
342 0.07
343 0.08
344 0.07
345 0.07
346 0.14
347 0.15
348 0.17
349 0.19
350 0.21
351 0.22
352 0.23
353 0.27
354 0.24
355 0.29
356 0.28
357 0.33
358 0.39
359 0.39
360 0.41
361 0.41
362 0.42
363 0.38
364 0.46
365 0.49
366 0.49
367 0.55
368 0.62
369 0.61
370 0.58
371 0.57
372 0.52
373 0.48
374 0.41
375 0.35
376 0.29
377 0.26
378 0.31
379 0.31
380 0.27
381 0.28
382 0.26
383 0.25
384 0.24
385 0.28
386 0.21
387 0.25
388 0.29
389 0.29
390 0.33
391 0.35
392 0.41
393 0.41
394 0.45
395 0.42
396 0.41
397 0.38
398 0.39
399 0.44
400 0.39
401 0.44
402 0.43
403 0.43
404 0.41
405 0.41
406 0.37
407 0.3
408 0.29
409 0.22
410 0.25
411 0.26
412 0.24
413 0.26
414 0.25
415 0.24
416 0.22
417 0.21
418 0.13
419 0.11
420 0.12
421 0.12
422 0.15
423 0.16
424 0.17
425 0.19
426 0.19
427 0.22
428 0.22
429 0.18
430 0.16
431 0.15
432 0.14
433 0.16
434 0.18
435 0.21
436 0.25
437 0.24
438 0.23
439 0.26
440 0.27
441 0.3
442 0.35
443 0.37
444 0.33
445 0.35
446 0.36
447 0.37
448 0.37
449 0.36
450 0.38
451 0.4
452 0.48
453 0.48
454 0.47
455 0.46
456 0.5
457 0.52
458 0.46
459 0.42
460 0.36
461 0.35
462 0.35
463 0.33
464 0.32
465 0.28
466 0.25
467 0.26
468 0.27
469 0.29
470 0.31
471 0.32
472 0.32
473 0.29
474 0.33
475 0.31
476 0.29
477 0.35
478 0.36
479 0.39