Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3Z996

Protein Details
Accession A0A2T3Z996    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
36-57LGGGGWRRRRRGKPNQPRIAKIBasic
NLS Segment(s)
PositionSequence
39-61GGWRRRRRGKPNQPRIAKIKNKR
Subcellular Location(s) extr 12, cyto 7, mito 4, pero 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGREKNLYKRAKDEECQGCVTFNLVLVAVVIWALRLGGGGWRRRRRGKPNQPRIAKIKNKRSQPPAVLVVCATSPPREAAHLCQCLLVSCLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.56
4 0.49
5 0.41
6 0.34
7 0.32
8 0.22
9 0.15
10 0.11
11 0.08
12 0.07
13 0.06
14 0.06
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.02
21 0.02
22 0.02
23 0.03
24 0.06
25 0.11
26 0.18
27 0.27
28 0.33
29 0.39
30 0.47
31 0.56
32 0.62
33 0.69
34 0.74
35 0.77
36 0.82
37 0.86
38 0.82
39 0.79
40 0.77
41 0.75
42 0.73
43 0.71
44 0.71
45 0.68
46 0.72
47 0.75
48 0.75
49 0.72
50 0.67
51 0.63
52 0.59
53 0.53
54 0.45
55 0.37
56 0.31
57 0.23
58 0.21
59 0.16
60 0.1
61 0.1
62 0.12
63 0.13
64 0.15
65 0.18
66 0.24
67 0.32
68 0.35
69 0.34
70 0.33
71 0.32
72 0.3