Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZKL3

Protein Details
Accession A0A2T3ZKL3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
147-173KRYPIGAPRQKRKSLRAPSTQKRAKGSHydrophilic
NLS Segment(s)
PositionSequence
153-171APRQKRKSLRAPSTQKRAK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MAKQKGNAGIQNRHIYSRASYLYQAASYLANCAHQTKKTTNTEDSQNDKRTDELSGAADGDGFAHSNQERKAIINLSHQVVSDMRSVSLKAQIRQSPAIKQTICKYCDAVQIEGKTCHSTVENLSKGGRKPWADVLVTRCDTCGNMKRYPIGAPRQKRKSLRAPSTQKRAKGSAAASEPVSAPELPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.38
4 0.38
5 0.33
6 0.27
7 0.26
8 0.26
9 0.26
10 0.24
11 0.22
12 0.16
13 0.14
14 0.12
15 0.13
16 0.11
17 0.11
18 0.12
19 0.15
20 0.18
21 0.21
22 0.26
23 0.29
24 0.38
25 0.43
26 0.48
27 0.49
28 0.49
29 0.53
30 0.55
31 0.56
32 0.55
33 0.54
34 0.5
35 0.46
36 0.43
37 0.36
38 0.31
39 0.25
40 0.19
41 0.14
42 0.13
43 0.13
44 0.11
45 0.1
46 0.09
47 0.08
48 0.06
49 0.05
50 0.05
51 0.07
52 0.08
53 0.11
54 0.12
55 0.14
56 0.14
57 0.15
58 0.17
59 0.18
60 0.19
61 0.22
62 0.24
63 0.23
64 0.23
65 0.22
66 0.2
67 0.17
68 0.17
69 0.14
70 0.12
71 0.1
72 0.1
73 0.1
74 0.1
75 0.16
76 0.17
77 0.17
78 0.22
79 0.24
80 0.26
81 0.3
82 0.31
83 0.29
84 0.29
85 0.32
86 0.27
87 0.26
88 0.31
89 0.33
90 0.33
91 0.3
92 0.3
93 0.27
94 0.33
95 0.33
96 0.29
97 0.25
98 0.26
99 0.27
100 0.26
101 0.25
102 0.2
103 0.18
104 0.16
105 0.13
106 0.13
107 0.15
108 0.22
109 0.22
110 0.22
111 0.24
112 0.27
113 0.27
114 0.29
115 0.3
116 0.23
117 0.25
118 0.3
119 0.33
120 0.31
121 0.33
122 0.34
123 0.36
124 0.36
125 0.33
126 0.27
127 0.23
128 0.22
129 0.26
130 0.31
131 0.28
132 0.3
133 0.32
134 0.35
135 0.36
136 0.4
137 0.41
138 0.42
139 0.47
140 0.54
141 0.62
142 0.68
143 0.76
144 0.77
145 0.78
146 0.79
147 0.8
148 0.79
149 0.8
150 0.82
151 0.83
152 0.87
153 0.85
154 0.8
155 0.75
156 0.7
157 0.62
158 0.58
159 0.51
160 0.48
161 0.45
162 0.41
163 0.36
164 0.34
165 0.31
166 0.25
167 0.26