Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZQZ4

Protein Details
Accession A0A2T3ZQZ4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-132FGPHKHKKPFVESKGRKFERARGRRRSRGFKVBasic
NLS Segment(s)
PositionSequence
97-132KHFGFGPHKHKKPFVESKGRKFERARGRRRSRGFKV
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSKINRPPVSLSRIVSNINKEGEKRTVVIVGTVTDDNRLLSFPKATIAALRFTATARARIAAAGGEAITLDQLALRAPTGSNTLILRGPKNSREAFKHFGFGPHKHKKPFVESKGRKFERARGRRRSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.39
4 0.36
5 0.35
6 0.35
7 0.32
8 0.34
9 0.34
10 0.32
11 0.28
12 0.25
13 0.24
14 0.22
15 0.21
16 0.17
17 0.14
18 0.14
19 0.14
20 0.12
21 0.11
22 0.11
23 0.1
24 0.1
25 0.1
26 0.09
27 0.09
28 0.1
29 0.09
30 0.1
31 0.11
32 0.1
33 0.13
34 0.13
35 0.13
36 0.13
37 0.13
38 0.12
39 0.12
40 0.18
41 0.15
42 0.17
43 0.15
44 0.15
45 0.15
46 0.14
47 0.14
48 0.08
49 0.07
50 0.05
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.07
67 0.07
68 0.09
69 0.09
70 0.11
71 0.13
72 0.14
73 0.15
74 0.17
75 0.21
76 0.22
77 0.28
78 0.3
79 0.32
80 0.37
81 0.42
82 0.44
83 0.41
84 0.42
85 0.36
86 0.4
87 0.41
88 0.42
89 0.46
90 0.5
91 0.56
92 0.57
93 0.63
94 0.6
95 0.65
96 0.69
97 0.68
98 0.69
99 0.71
100 0.77
101 0.83
102 0.8
103 0.78
104 0.71
105 0.71
106 0.7
107 0.72
108 0.72
109 0.72
110 0.8
111 0.83
112 0.89