Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3YSY6

Protein Details
Accession A0A2T3YSY6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-43VTSCSECYRRKQRCDRKSPCNNCLARHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MRTPASGRQQALKRKRVVTSCSECYRRKQRCDRKSPCNNCLARNIPNKCIFNTLLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.64
4 0.61
5 0.6
6 0.58
7 0.56
8 0.57
9 0.59
10 0.55
11 0.57
12 0.63
13 0.62
14 0.63
15 0.67
16 0.72
17 0.75
18 0.84
19 0.85
20 0.85
21 0.88
22 0.88
23 0.82
24 0.8
25 0.73
26 0.65
27 0.64
28 0.58
29 0.56
30 0.57
31 0.56
32 0.54
33 0.59
34 0.58
35 0.52
36 0.53