Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZPQ7

Protein Details
Accession A0A2T3ZPQ7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
130-156GAMRCAKQRLGRRRSQRRRRWWMVEVSHydrophilic
NLS Segment(s)
PositionSequence
138-149RLGRRRSQRRRR
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
Amino Acid Sequences MPHRQRVNAGARLSKQWPGGLWTIQDQSKGGCWTAASLDTGSCGGTAGEAQVCVVLLAAHGGLPRRRTTSRLTGGNGQGGIRWPGFSRDAEQQTANDWPAAHGARWTMRHGWAPMLGRSWMPSWVSADHGAMRCAKQRLGRRRSQRRRRWWMVEVSDTNRRLALIGRGEKRNRTYALGAHCSRRAGAVEAGNTLRCLRPQAACCGACTPYYSIGRLSTNRASAVSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.36
4 0.33
5 0.3
6 0.31
7 0.28
8 0.27
9 0.26
10 0.28
11 0.28
12 0.28
13 0.24
14 0.21
15 0.23
16 0.23
17 0.2
18 0.16
19 0.15
20 0.15
21 0.16
22 0.16
23 0.13
24 0.12
25 0.11
26 0.11
27 0.12
28 0.1
29 0.08
30 0.07
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.06
40 0.05
41 0.05
42 0.04
43 0.03
44 0.04
45 0.04
46 0.04
47 0.05
48 0.08
49 0.11
50 0.14
51 0.16
52 0.21
53 0.23
54 0.25
55 0.31
56 0.37
57 0.42
58 0.44
59 0.45
60 0.46
61 0.46
62 0.45
63 0.39
64 0.29
65 0.23
66 0.19
67 0.18
68 0.12
69 0.11
70 0.09
71 0.12
72 0.14
73 0.14
74 0.16
75 0.21
76 0.23
77 0.24
78 0.24
79 0.22
80 0.21
81 0.23
82 0.2
83 0.14
84 0.11
85 0.09
86 0.12
87 0.12
88 0.1
89 0.09
90 0.1
91 0.12
92 0.14
93 0.16
94 0.15
95 0.16
96 0.18
97 0.18
98 0.18
99 0.18
100 0.18
101 0.17
102 0.16
103 0.15
104 0.12
105 0.13
106 0.13
107 0.12
108 0.1
109 0.1
110 0.11
111 0.11
112 0.13
113 0.12
114 0.12
115 0.13
116 0.13
117 0.14
118 0.14
119 0.14
120 0.17
121 0.18
122 0.2
123 0.23
124 0.32
125 0.42
126 0.48
127 0.55
128 0.62
129 0.72
130 0.81
131 0.85
132 0.86
133 0.87
134 0.9
135 0.9
136 0.87
137 0.82
138 0.79
139 0.73
140 0.69
141 0.62
142 0.56
143 0.55
144 0.48
145 0.43
146 0.34
147 0.29
148 0.22
149 0.2
150 0.21
151 0.21
152 0.28
153 0.33
154 0.41
155 0.44
156 0.49
157 0.51
158 0.51
159 0.46
160 0.42
161 0.39
162 0.37
163 0.41
164 0.44
165 0.42
166 0.41
167 0.41
168 0.37
169 0.35
170 0.32
171 0.26
172 0.21
173 0.23
174 0.22
175 0.21
176 0.23
177 0.24
178 0.23
179 0.22
180 0.2
181 0.18
182 0.15
183 0.18
184 0.19
185 0.24
186 0.27
187 0.34
188 0.41
189 0.4
190 0.41
191 0.4
192 0.38
193 0.32
194 0.31
195 0.26
196 0.25
197 0.27
198 0.27
199 0.26
200 0.28
201 0.32
202 0.32
203 0.36
204 0.34
205 0.34
206 0.34