Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3Z9W2

Protein Details
Accession A0A2T3Z9W2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-83VHVRDGPRPGRPKKKREQLVEQNTVVHydrophilic
NLS Segment(s)
PositionSequence
64-73PRPGRPKKKR
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Pfam View protein in Pfam  
PF13384  HTH_23  
Amino Acid Sequences MPPHDIATRAQALTLKLLGVSNQDIQRLTGIHPRTVHNIMDRAIERGLDLNNPVILEVHVRDGPRPGRPKKKREQLVEQNTVVGEHRSLIALPSVDLEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.16
3 0.13
4 0.13
5 0.12
6 0.12
7 0.14
8 0.17
9 0.17
10 0.19
11 0.19
12 0.19
13 0.19
14 0.18
15 0.17
16 0.19
17 0.19
18 0.21
19 0.23
20 0.25
21 0.29
22 0.3
23 0.29
24 0.25
25 0.26
26 0.23
27 0.25
28 0.23
29 0.2
30 0.17
31 0.15
32 0.13
33 0.12
34 0.12
35 0.08
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.08
46 0.09
47 0.1
48 0.1
49 0.15
50 0.18
51 0.24
52 0.33
53 0.39
54 0.49
55 0.58
56 0.67
57 0.73
58 0.81
59 0.83
60 0.82
61 0.84
62 0.84
63 0.85
64 0.82
65 0.72
66 0.62
67 0.53
68 0.46
69 0.36
70 0.26
71 0.16
72 0.1
73 0.1
74 0.09
75 0.1
76 0.1
77 0.11
78 0.11
79 0.11