Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4UPS8

Protein Details
Accession A0A2S4UPS8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
143-164EDPSAQQKHKPHVMKKKKDFRVBasic
NLS Segment(s)
PositionSequence
154-160HVMKKKK
Subcellular Location(s) cyto 10.5, cyto_nucl 8.833, mito 8.5, mito_nucl 7.833, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR014842  AFT  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0036086  P:positive regulation of transcription from RNA polymerase II promoter in response to iron ion starvation  
Pfam View protein in Pfam  
PF08731  AFT  
Amino Acid Sequences MKSIQDWALKNGFAIVVKSLYKGKGKEGKGDHLHRTNFVCDKSGKYRPHCPPTHPATSGSTEVPAEAEEEASLPEAPKETVSASTKTEKDAKGTGATSTKIKKNANVSRKTGCPFQLVLNHDPDTFKWDLTVSNLDHNHKPSEDPSAQQKHKPHVMKKKKDFRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.14
4 0.14
5 0.16
6 0.19
7 0.21
8 0.26
9 0.26
10 0.33
11 0.39
12 0.41
13 0.47
14 0.49
15 0.54
16 0.57
17 0.62
18 0.61
19 0.6
20 0.6
21 0.55
22 0.53
23 0.48
24 0.44
25 0.38
26 0.34
27 0.28
28 0.32
29 0.36
30 0.42
31 0.44
32 0.46
33 0.55
34 0.6
35 0.68
36 0.66
37 0.64
38 0.64
39 0.63
40 0.64
41 0.56
42 0.48
43 0.42
44 0.42
45 0.38
46 0.3
47 0.24
48 0.17
49 0.15
50 0.13
51 0.1
52 0.08
53 0.06
54 0.05
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.09
68 0.12
69 0.13
70 0.15
71 0.19
72 0.19
73 0.21
74 0.25
75 0.22
76 0.22
77 0.22
78 0.21
79 0.2
80 0.2
81 0.19
82 0.16
83 0.17
84 0.18
85 0.21
86 0.24
87 0.28
88 0.28
89 0.31
90 0.39
91 0.47
92 0.53
93 0.55
94 0.56
95 0.54
96 0.57
97 0.55
98 0.49
99 0.42
100 0.36
101 0.31
102 0.3
103 0.32
104 0.32
105 0.32
106 0.33
107 0.32
108 0.29
109 0.29
110 0.25
111 0.25
112 0.21
113 0.18
114 0.14
115 0.13
116 0.14
117 0.17
118 0.21
119 0.17
120 0.23
121 0.27
122 0.3
123 0.34
124 0.36
125 0.36
126 0.31
127 0.33
128 0.27
129 0.32
130 0.3
131 0.3
132 0.37
133 0.44
134 0.48
135 0.52
136 0.57
137 0.56
138 0.64
139 0.69
140 0.69
141 0.71
142 0.78
143 0.82
144 0.87