Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VAH7

Protein Details
Accession A0A2S4VAH7   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-36KSGDRIRRFPPNPQPKKRSNYPRRVRTPGTTHydrophilic
NLS Segment(s)
PositionSequence
20-23PKKR
Subcellular Location(s) plas 11, nucl 7.5, cyto_nucl 5, mito 3, pero 2, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences VLCSDKSGDRIRRFPPNPQPKKRSNYPRRVRTPGTTPTQTQASTWRASTSGSKEPKMTVTRMIYNSIMKRNSTYVSTIFAGSFIFSIGLIRLLLVGGNNIINKNYGPLLEITSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.71
4 0.75
5 0.79
6 0.81
7 0.79
8 0.84
9 0.85
10 0.85
11 0.85
12 0.85
13 0.85
14 0.87
15 0.87
16 0.86
17 0.81
18 0.75
19 0.71
20 0.67
21 0.64
22 0.56
23 0.49
24 0.44
25 0.42
26 0.37
27 0.3
28 0.29
29 0.25
30 0.23
31 0.22
32 0.2
33 0.17
34 0.18
35 0.21
36 0.19
37 0.24
38 0.26
39 0.27
40 0.27
41 0.27
42 0.31
43 0.3
44 0.26
45 0.23
46 0.22
47 0.26
48 0.26
49 0.28
50 0.24
51 0.26
52 0.27
53 0.28
54 0.27
55 0.23
56 0.23
57 0.23
58 0.23
59 0.21
60 0.2
61 0.16
62 0.17
63 0.18
64 0.17
65 0.15
66 0.13
67 0.12
68 0.1
69 0.09
70 0.06
71 0.05
72 0.04
73 0.05
74 0.05
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.07
85 0.09
86 0.1
87 0.1
88 0.11
89 0.11
90 0.13
91 0.13
92 0.12
93 0.12
94 0.13