Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4UR08

Protein Details
Accession A0A2S4UR08    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-27RPLPAKSKKMNGLNEKNQNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009643  HS1-bd  
Gene Ontology GO:0003714  F:transcription corepressor activity  
Pfam View protein in Pfam  
PF06825  HSBP1  
Amino Acid Sequences TKPISFHRPLPAKSKKMNGLNEKNQNSNQKTYSSTQTTSALKNSSSATASGSANPTDDQTAPEFNPNDICSPHELIGWVDDVLEKLESKFSRIETDVIERLDILGKRIDSLELSMSGLLDGATQPNNPNTQQPNAASYRVPKSPDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.69
4 0.75
5 0.75
6 0.76
7 0.77
8 0.81
9 0.76
10 0.73
11 0.7
12 0.7
13 0.64
14 0.59
15 0.52
16 0.44
17 0.45
18 0.43
19 0.44
20 0.39
21 0.36
22 0.33
23 0.35
24 0.35
25 0.33
26 0.32
27 0.27
28 0.22
29 0.22
30 0.21
31 0.18
32 0.16
33 0.15
34 0.13
35 0.14
36 0.14
37 0.14
38 0.15
39 0.13
40 0.13
41 0.13
42 0.12
43 0.11
44 0.11
45 0.11
46 0.1
47 0.12
48 0.12
49 0.16
50 0.16
51 0.14
52 0.16
53 0.15
54 0.15
55 0.14
56 0.14
57 0.13
58 0.14
59 0.14
60 0.12
61 0.11
62 0.1
63 0.11
64 0.1
65 0.07
66 0.06
67 0.05
68 0.05
69 0.05
70 0.06
71 0.05
72 0.05
73 0.1
74 0.1
75 0.12
76 0.13
77 0.14
78 0.17
79 0.18
80 0.19
81 0.16
82 0.21
83 0.22
84 0.2
85 0.19
86 0.16
87 0.15
88 0.18
89 0.16
90 0.13
91 0.13
92 0.13
93 0.14
94 0.14
95 0.14
96 0.11
97 0.12
98 0.12
99 0.1
100 0.1
101 0.1
102 0.09
103 0.08
104 0.08
105 0.06
106 0.05
107 0.05
108 0.06
109 0.07
110 0.09
111 0.11
112 0.14
113 0.18
114 0.19
115 0.26
116 0.28
117 0.31
118 0.36
119 0.35
120 0.38
121 0.38
122 0.39
123 0.34
124 0.36
125 0.38
126 0.37