Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VG82

Protein Details
Accession A0A2S4VG82   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-80QSPTHEGKPRPKFKRPTVEVRSRFPHydrophilic
NLS Segment(s)
PositionSequence
63-69KPRPKFK
Subcellular Location(s) nucl 11, mito 9, cyto 3, plas 1, extr 1, pero 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MYTQNARLNSLVLILACLFMGAISQPLTSSNTAKNFILEGRSHWPVDAALERRGSQSPTHEGKPRPKFKRPTVEVRSRFPLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.06
5 0.05
6 0.04
7 0.04
8 0.03
9 0.04
10 0.05
11 0.05
12 0.05
13 0.06
14 0.09
15 0.1
16 0.12
17 0.16
18 0.18
19 0.2
20 0.2
21 0.19
22 0.17
23 0.17
24 0.17
25 0.13
26 0.14
27 0.16
28 0.18
29 0.17
30 0.17
31 0.16
32 0.13
33 0.15
34 0.17
35 0.15
36 0.16
37 0.17
38 0.18
39 0.2
40 0.21
41 0.21
42 0.18
43 0.2
44 0.25
45 0.28
46 0.32
47 0.37
48 0.42
49 0.51
50 0.6
51 0.66
52 0.66
53 0.71
54 0.77
55 0.8
56 0.85
57 0.82
58 0.82
59 0.81
60 0.84
61 0.8
62 0.78