A0A2S4VCB8
Protein Details
| Accession | A0A2S4VCB8  |
Localization Confidence | Medium | Confidence Score | 10.8 | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| NoLS Segment(s) |
|
||||||||||
| NLS Segment(s) |
|
||||||||||
| Subcellular Location(s) | mito 16, nucl 8.5, cyto_nucl 6 | ||||||||||
| Family & Domain DBs |
|
||||||||||
| Amino Acid Sequences | MISRVSSVEMDVHQFKKRRKRRKLVMRNHKK | ||||||||||
| FASTA Sequence with NoLS information |
|||||||||||
| AlphaFold Structure with highlighted NoLS |
|||||||||||
NoLS Predictions per Residue
| Residue Number | Score |
|---|---|
| 1 | 0.3 |
| 2 | 0.36 |
| 3 | 0.44 |
| 4 | 0.54 |
| 5 | 0.61 |
| 6 | 0.68 |
| 7 | 0.76 |
| 8 | 0.82 |
| 9 | 0.88 |
| 10 | 0.93 |
| 11 | 0.93 |