Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VY12

Protein Details
Accession A0A2S4VY12   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
177-198KGSSKSSKSKKSYDNSNYSRKIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, cyto 4, mito 3, cyto_nucl 3, pero 3, nucl 2, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MIALVCFALRCTLAAPSLDVSTAPIQIFHSRIFNLKAVSSGLGPISQTKKIHTEVPGGKNVELQVPRQQNSRKEFKSNIMKPPQARMKMDRTRTPTQEEEIKINNILNNYPVGHAYQLTDTPEPVILAAPIFDFEYACGKDKIYGIDGALIKETGCFHWNGPCVEECLVEAYVDCLKGSSKSSKSKKSYDNSNYSRKII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.14
5 0.14
6 0.13
7 0.14
8 0.13
9 0.15
10 0.13
11 0.13
12 0.15
13 0.18
14 0.2
15 0.18
16 0.2
17 0.19
18 0.22
19 0.24
20 0.25
21 0.23
22 0.21
23 0.21
24 0.19
25 0.19
26 0.16
27 0.13
28 0.11
29 0.1
30 0.1
31 0.14
32 0.16
33 0.2
34 0.21
35 0.22
36 0.26
37 0.28
38 0.32
39 0.29
40 0.35
41 0.38
42 0.42
43 0.45
44 0.42
45 0.41
46 0.38
47 0.36
48 0.32
49 0.26
50 0.23
51 0.25
52 0.29
53 0.3
54 0.35
55 0.39
56 0.41
57 0.46
58 0.54
59 0.49
60 0.49
61 0.5
62 0.52
63 0.58
64 0.56
65 0.59
66 0.56
67 0.57
68 0.53
69 0.58
70 0.57
71 0.51
72 0.48
73 0.44
74 0.47
75 0.5
76 0.54
77 0.52
78 0.52
79 0.53
80 0.52
81 0.52
82 0.44
83 0.39
84 0.4
85 0.35
86 0.31
87 0.27
88 0.25
89 0.21
90 0.2
91 0.19
92 0.13
93 0.12
94 0.1
95 0.09
96 0.09
97 0.09
98 0.09
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.09
105 0.11
106 0.1
107 0.1
108 0.1
109 0.1
110 0.09
111 0.08
112 0.07
113 0.05
114 0.05
115 0.05
116 0.04
117 0.04
118 0.05
119 0.05
120 0.04
121 0.05
122 0.1
123 0.11
124 0.13
125 0.13
126 0.13
127 0.16
128 0.17
129 0.18
130 0.16
131 0.15
132 0.13
133 0.18
134 0.19
135 0.17
136 0.16
137 0.14
138 0.12
139 0.12
140 0.13
141 0.1
142 0.1
143 0.11
144 0.11
145 0.18
146 0.22
147 0.21
148 0.23
149 0.22
150 0.23
151 0.23
152 0.22
153 0.16
154 0.16
155 0.15
156 0.12
157 0.11
158 0.11
159 0.12
160 0.12
161 0.12
162 0.09
163 0.1
164 0.12
165 0.16
166 0.23
167 0.28
168 0.39
169 0.48
170 0.58
171 0.64
172 0.71
173 0.76
174 0.75
175 0.79
176 0.78
177 0.8
178 0.78
179 0.81