Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4UBQ8

Protein Details
Accession A0A2S4UBQ8   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-107DFRNKHKKDPRFKNFGRDERBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002713  FF_domain  
IPR036517  FF_domain_sf  
IPR045148  TCRG1-like  
Gene Ontology GO:0070063  F:RNA polymerase binding  
GO:0003712  F:transcription coregulator activity  
Pfam View protein in Pfam  
PF01846  FF  
PROSITE View protein in PROSITE  
PS51676  FF  
Amino Acid Sequences TMLSEESVDPMAPRDNELPKFGTDARYLGEELGCFCKMRDVTYLMNFAKRKFDQQRAAKQAIPKIDPSQAYRSLLIEFVTSTRTLYEDFRNKHKKDPRFKNFGRDERERERAFKNWLQELGEQNDNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.3
4 0.33
5 0.33
6 0.29
7 0.32
8 0.3
9 0.29
10 0.23
11 0.22
12 0.2
13 0.2
14 0.19
15 0.16
16 0.15
17 0.12
18 0.12
19 0.15
20 0.14
21 0.12
22 0.12
23 0.17
24 0.16
25 0.18
26 0.19
27 0.19
28 0.22
29 0.24
30 0.3
31 0.25
32 0.32
33 0.31
34 0.28
35 0.32
36 0.3
37 0.36
38 0.37
39 0.44
40 0.48
41 0.55
42 0.64
43 0.63
44 0.65
45 0.58
46 0.54
47 0.49
48 0.43
49 0.36
50 0.28
51 0.23
52 0.24
53 0.24
54 0.24
55 0.25
56 0.24
57 0.25
58 0.23
59 0.22
60 0.19
61 0.18
62 0.15
63 0.11
64 0.08
65 0.07
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.11
73 0.19
74 0.26
75 0.29
76 0.39
77 0.48
78 0.49
79 0.58
80 0.64
81 0.66
82 0.69
83 0.77
84 0.76
85 0.77
86 0.78
87 0.79
88 0.8
89 0.79
90 0.76
91 0.73
92 0.71
93 0.68
94 0.75
95 0.67
96 0.62
97 0.58
98 0.56
99 0.56
100 0.52
101 0.51
102 0.48
103 0.48
104 0.46
105 0.46
106 0.46
107 0.44