Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4W0N2

Protein Details
Accession A0A2S4W0N2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-48RLDLRKNRKGKYRIRRQRYEISTBasic
NLS Segment(s)
PositionSequence
31-40KNRKGKYRIR
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MFKCTQSGQLRLWLLKPIFSFRCIIRLDLRKNRKGKYRIRRQRYEISTESDSSRWPLPPGVGLITNLLHCMITWMMGLLGEFLAHRGLLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.32
4 0.31
5 0.29
6 0.29
7 0.31
8 0.24
9 0.3
10 0.27
11 0.28
12 0.29
13 0.36
14 0.43
15 0.51
16 0.59
17 0.6
18 0.65
19 0.68
20 0.7
21 0.7
22 0.72
23 0.73
24 0.75
25 0.78
26 0.81
27 0.84
28 0.81
29 0.81
30 0.75
31 0.71
32 0.61
33 0.56
34 0.48
35 0.42
36 0.37
37 0.27
38 0.24
39 0.19
40 0.19
41 0.14
42 0.13
43 0.13
44 0.12
45 0.12
46 0.13
47 0.13
48 0.12
49 0.11
50 0.12
51 0.12
52 0.11
53 0.1
54 0.09
55 0.08
56 0.07
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.07
64 0.07
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06