Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4UPU8

Protein Details
Accession A0A2S4UPU8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
161-191ERELAEKAKINKKQKKIELKAKNKKAKSLMSHydrophilic
NLS Segment(s)
PositionSequence
165-187AEKAKINKKQKKIELKAKNKKAK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MIKIQQRRHRGDGDEEEQETEILDPSRPAIPDDDDEQPQVVDETDISGMGRLSDEEEEVDEDSPEVVVLKEGKHLTKEEFEAEKIRLRDHPDTPSTLPTSSRTSIKPSLTFSSNNKPSTSSIGKRKGPTIDDVEPNDSGWSDLVKRTKGEKPALVSTIKEERELAEKAKINKKQKKIELKAKNKKAKSLMSFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.5
3 0.45
4 0.39
5 0.35
6 0.26
7 0.18
8 0.15
9 0.11
10 0.1
11 0.09
12 0.11
13 0.14
14 0.14
15 0.15
16 0.15
17 0.18
18 0.2
19 0.23
20 0.26
21 0.24
22 0.24
23 0.23
24 0.2
25 0.17
26 0.15
27 0.12
28 0.08
29 0.06
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.06
38 0.05
39 0.06
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.09
46 0.09
47 0.07
48 0.07
49 0.07
50 0.06
51 0.05
52 0.05
53 0.04
54 0.05
55 0.06
56 0.06
57 0.1
58 0.12
59 0.13
60 0.14
61 0.16
62 0.17
63 0.18
64 0.19
65 0.19
66 0.19
67 0.19
68 0.2
69 0.2
70 0.22
71 0.2
72 0.2
73 0.2
74 0.24
75 0.27
76 0.27
77 0.3
78 0.28
79 0.3
80 0.3
81 0.3
82 0.26
83 0.22
84 0.2
85 0.18
86 0.21
87 0.19
88 0.2
89 0.19
90 0.23
91 0.27
92 0.29
93 0.28
94 0.27
95 0.28
96 0.28
97 0.3
98 0.29
99 0.34
100 0.38
101 0.37
102 0.35
103 0.33
104 0.32
105 0.36
106 0.38
107 0.35
108 0.38
109 0.44
110 0.49
111 0.49
112 0.52
113 0.49
114 0.44
115 0.43
116 0.4
117 0.36
118 0.36
119 0.37
120 0.35
121 0.32
122 0.3
123 0.26
124 0.19
125 0.15
126 0.1
127 0.09
128 0.08
129 0.13
130 0.16
131 0.18
132 0.2
133 0.25
134 0.31
135 0.37
136 0.41
137 0.41
138 0.42
139 0.45
140 0.47
141 0.43
142 0.37
143 0.35
144 0.37
145 0.34
146 0.29
147 0.24
148 0.23
149 0.26
150 0.28
151 0.25
152 0.25
153 0.29
154 0.36
155 0.45
156 0.53
157 0.59
158 0.66
159 0.73
160 0.76
161 0.81
162 0.85
163 0.86
164 0.88
165 0.88
166 0.9
167 0.92
168 0.92
169 0.92
170 0.85
171 0.84
172 0.81
173 0.79