Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4ULW4

Protein Details
Accession A0A2S4ULW4   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-34RANGRGKPNKCERCRVKRVTCNREPEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10.833, mito_nucl 10.333, cyto 7.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MTCGQSTRANGRGKPNKCERCRVKRVTCNREPEVESKVKRVVWADPRTGSTFEAPFQTTSETATMTPSDPTMIREEGDYAAPWVFGEKTSESCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.72
4 0.71
5 0.77
6 0.77
7 0.78
8 0.83
9 0.84
10 0.83
11 0.82
12 0.88
13 0.87
14 0.84
15 0.82
16 0.74
17 0.69
18 0.61
19 0.54
20 0.5
21 0.47
22 0.41
23 0.35
24 0.36
25 0.31
26 0.3
27 0.29
28 0.28
29 0.3
30 0.33
31 0.33
32 0.31
33 0.33
34 0.33
35 0.32
36 0.27
37 0.19
38 0.16
39 0.14
40 0.15
41 0.14
42 0.12
43 0.12
44 0.13
45 0.11
46 0.11
47 0.11
48 0.1
49 0.09
50 0.1
51 0.1
52 0.1
53 0.1
54 0.09
55 0.1
56 0.1
57 0.12
58 0.14
59 0.14
60 0.14
61 0.14
62 0.15
63 0.15
64 0.16
65 0.14
66 0.12
67 0.11
68 0.11
69 0.1
70 0.1
71 0.1
72 0.09
73 0.13
74 0.13