Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4W1B7

Protein Details
Accession A0A2S4W1B7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-41PPSHTRKRGVWCKGRTNPRPSKKKILRVSTHydrophilic
NLS Segment(s)
PositionSequence
26-35RTNPRPSKKK
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences ASRSFKPNQFGPPSHTRKRGVWCKGRTNPRPSKKKILRVSTPTQYAQSDNPNCSRSHRVQPTQIETTIYKENHNNDDRHDNETSHDGGLRTENGKYDKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.62
4 0.6
5 0.68
6 0.7
7 0.69
8 0.71
9 0.7
10 0.74
11 0.79
12 0.83
13 0.81
14 0.82
15 0.82
16 0.83
17 0.85
18 0.81
19 0.83
20 0.81
21 0.83
22 0.81
23 0.79
24 0.77
25 0.74
26 0.74
27 0.68
28 0.63
29 0.53
30 0.46
31 0.39
32 0.32
33 0.27
34 0.29
35 0.26
36 0.25
37 0.27
38 0.27
39 0.26
40 0.28
41 0.32
42 0.28
43 0.36
44 0.41
45 0.43
46 0.48
47 0.53
48 0.55
49 0.52
50 0.48
51 0.41
52 0.34
53 0.33
54 0.33
55 0.28
56 0.25
57 0.26
58 0.29
59 0.35
60 0.4
61 0.37
62 0.35
63 0.43
64 0.43
65 0.43
66 0.41
67 0.33
68 0.31
69 0.33
70 0.3
71 0.22
72 0.23
73 0.18
74 0.17
75 0.2
76 0.2
77 0.19
78 0.18
79 0.23