Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VQT2

Protein Details
Accession A0A2S4VQT2   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
181-201LEYFKEKRKIAWERLKKKEIDBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 11.833, mito 9, cyto_mito 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MRLQKPLEDRWYHVSHQVSKYCGCLAQVKRRARSGTNQIDFPLEAKALFRQDNGNKQFGLDHCWAILHCHPKWLGYLNEAALGGKSKAKEKKVSRGSTPDPTAVDVLSSGQAQESEIEVSGRPEGCKSAKKRKHDEINISELIKSQKEMLELSRKKQESFESFADDMVMGRNLTGMDEEALEYFKEKRKIAWERLKKKEIDWVDAFEKHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.52
4 0.51
5 0.47
6 0.44
7 0.44
8 0.39
9 0.34
10 0.28
11 0.29
12 0.33
13 0.41
14 0.48
15 0.54
16 0.58
17 0.63
18 0.65
19 0.6
20 0.62
21 0.61
22 0.63
23 0.58
24 0.55
25 0.49
26 0.47
27 0.43
28 0.34
29 0.25
30 0.15
31 0.11
32 0.11
33 0.13
34 0.15
35 0.16
36 0.16
37 0.22
38 0.27
39 0.37
40 0.4
41 0.39
42 0.35
43 0.35
44 0.37
45 0.3
46 0.31
47 0.23
48 0.2
49 0.17
50 0.18
51 0.17
52 0.17
53 0.21
54 0.21
55 0.19
56 0.23
57 0.23
58 0.23
59 0.24
60 0.25
61 0.22
62 0.17
63 0.19
64 0.15
65 0.16
66 0.15
67 0.14
68 0.1
69 0.1
70 0.09
71 0.09
72 0.1
73 0.15
74 0.21
75 0.25
76 0.34
77 0.37
78 0.47
79 0.54
80 0.57
81 0.54
82 0.56
83 0.56
84 0.53
85 0.51
86 0.42
87 0.33
88 0.3
89 0.26
90 0.19
91 0.15
92 0.09
93 0.07
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.08
108 0.08
109 0.07
110 0.07
111 0.1
112 0.13
113 0.2
114 0.27
115 0.37
116 0.43
117 0.52
118 0.59
119 0.67
120 0.74
121 0.75
122 0.77
123 0.71
124 0.71
125 0.65
126 0.57
127 0.47
128 0.39
129 0.33
130 0.24
131 0.19
132 0.14
133 0.13
134 0.14
135 0.15
136 0.17
137 0.26
138 0.28
139 0.32
140 0.39
141 0.39
142 0.39
143 0.41
144 0.44
145 0.38
146 0.42
147 0.4
148 0.38
149 0.37
150 0.36
151 0.33
152 0.25
153 0.2
154 0.15
155 0.14
156 0.07
157 0.07
158 0.08
159 0.07
160 0.07
161 0.08
162 0.07
163 0.06
164 0.07
165 0.08
166 0.08
167 0.08
168 0.08
169 0.09
170 0.12
171 0.18
172 0.24
173 0.24
174 0.28
175 0.38
176 0.47
177 0.56
178 0.64
179 0.68
180 0.73
181 0.82
182 0.86
183 0.77
184 0.7
185 0.69
186 0.63
187 0.6
188 0.53
189 0.49
190 0.46