Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4UFB6

Protein Details
Accession A0A2S4UFB6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
85-106KWLCIMPKCYTRQKKSGKKSSDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 8, plas 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQSTGGLIWSGLIVSSIAMMALISFQPSVVLSTGSRSGAAQKPLAQLTKGTPAGRLVRCGRMIADRNPDPLMNRGPFFCTDDQAKWLCIMPKCYTRQKKSGKKSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.05
15 0.07
16 0.06
17 0.07
18 0.07
19 0.09
20 0.11
21 0.11
22 0.11
23 0.1
24 0.15
25 0.17
26 0.2
27 0.19
28 0.2
29 0.22
30 0.24
31 0.25
32 0.2
33 0.17
34 0.16
35 0.21
36 0.21
37 0.19
38 0.17
39 0.19
40 0.25
41 0.25
42 0.27
43 0.23
44 0.25
45 0.25
46 0.25
47 0.23
48 0.23
49 0.27
50 0.27
51 0.32
52 0.3
53 0.31
54 0.32
55 0.32
56 0.27
57 0.27
58 0.28
59 0.23
60 0.22
61 0.21
62 0.22
63 0.23
64 0.26
65 0.23
66 0.21
67 0.22
68 0.22
69 0.26
70 0.25
71 0.24
72 0.21
73 0.23
74 0.25
75 0.25
76 0.29
77 0.3
78 0.37
79 0.43
80 0.53
81 0.61
82 0.62
83 0.69
84 0.75
85 0.81
86 0.84