Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4VYH2

Protein Details
Accession A0A2S4VYH2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
80-102AEPTCRKRRKITFGKYQIRKVHCHydrophilic
NLS Segment(s)
PositionSequence
73-89KKRKARVAEPTCRKRRK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences VSRKSGEIRASELSIDDPRLPEQQATEHAEHARIAFSNRRKQMTKKATDKPNLISSEDRARIIDLNAMHLAEKKRKARVAEPTCRKRRKITFGKYQIRKVHCTEKASFLWCFDRRGGKRGRVHTHVWRALV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.19
4 0.17
5 0.19
6 0.21
7 0.21
8 0.19
9 0.18
10 0.19
11 0.24
12 0.28
13 0.26
14 0.27
15 0.27
16 0.27
17 0.25
18 0.22
19 0.18
20 0.13
21 0.15
22 0.19
23 0.26
24 0.34
25 0.39
26 0.44
27 0.47
28 0.52
29 0.6
30 0.62
31 0.64
32 0.64
33 0.68
34 0.71
35 0.74
36 0.71
37 0.64
38 0.61
39 0.53
40 0.46
41 0.38
42 0.32
43 0.33
44 0.32
45 0.28
46 0.21
47 0.2
48 0.18
49 0.18
50 0.18
51 0.1
52 0.11
53 0.11
54 0.1
55 0.1
56 0.13
57 0.15
58 0.17
59 0.24
60 0.25
61 0.3
62 0.34
63 0.37
64 0.39
65 0.48
66 0.52
67 0.56
68 0.63
69 0.69
70 0.75
71 0.79
72 0.76
73 0.74
74 0.74
75 0.74
76 0.74
77 0.73
78 0.74
79 0.79
80 0.86
81 0.83
82 0.83
83 0.8
84 0.74
85 0.7
86 0.64
87 0.63
88 0.58
89 0.57
90 0.51
91 0.5
92 0.48
93 0.47
94 0.43
95 0.36
96 0.38
97 0.35
98 0.35
99 0.33
100 0.4
101 0.39
102 0.47
103 0.52
104 0.53
105 0.6
106 0.67
107 0.71
108 0.66
109 0.7
110 0.72
111 0.75