Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4UMK5

Protein Details
Accession A0A2S4UMK5   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSTTPHSIKEHQKKIKLPQSRSHydrophilic
NLS Segment(s)
PositionSequence
225-248KKPMKTSPNEKSTGRLQGKKKHVP
Subcellular Location(s) nucl 23, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MSTTPHSIKEHQKKIKLPQSRSSEPRTPIKLEDKPPILPIIPSPTNPFVADPSAMASDELPSSPLDPHNPLASQQSRDAYLTARRRETLELPAGVEHLHLPPREQIYPAEINLSDIPLSVAMRREPNTTPIGRWLQAVEPMSPTNDPALRPASHWSSDSEPTTLSDSNSWISKLHEKAAHNFEFNRRDLSSPEGISPTNPGYRAAGIQPFAGSSSSRPFPASPSKKPMKTSPNEKSTGRLQGKKKHVPPPILTNRRIAVVIPLSKLRQGKPTTRKGKVSSQKAVLAPSGSALRPCNQPIFCCPICGFRLPLLTAINQHIRDNHPRAYNPTNGDVNDHEHEPSEEGTLCKNLVELSLSDVPQESAPGAIIMKALPSGNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.82
4 0.79
5 0.77
6 0.77
7 0.78
8 0.77
9 0.75
10 0.73
11 0.7
12 0.72
13 0.68
14 0.63
15 0.61
16 0.64
17 0.63
18 0.61
19 0.64
20 0.59
21 0.55
22 0.53
23 0.49
24 0.41
25 0.33
26 0.3
27 0.3
28 0.28
29 0.28
30 0.32
31 0.31
32 0.33
33 0.32
34 0.3
35 0.24
36 0.24
37 0.23
38 0.17
39 0.17
40 0.16
41 0.15
42 0.14
43 0.12
44 0.11
45 0.11
46 0.11
47 0.09
48 0.09
49 0.1
50 0.12
51 0.14
52 0.16
53 0.19
54 0.21
55 0.23
56 0.23
57 0.23
58 0.3
59 0.31
60 0.31
61 0.31
62 0.31
63 0.3
64 0.3
65 0.29
66 0.24
67 0.29
68 0.34
69 0.36
70 0.37
71 0.37
72 0.38
73 0.42
74 0.42
75 0.4
76 0.37
77 0.32
78 0.3
79 0.29
80 0.26
81 0.22
82 0.2
83 0.13
84 0.1
85 0.14
86 0.13
87 0.14
88 0.18
89 0.22
90 0.23
91 0.23
92 0.21
93 0.23
94 0.25
95 0.24
96 0.22
97 0.18
98 0.2
99 0.19
100 0.18
101 0.12
102 0.1
103 0.1
104 0.08
105 0.08
106 0.08
107 0.09
108 0.1
109 0.15
110 0.16
111 0.19
112 0.2
113 0.24
114 0.27
115 0.27
116 0.26
117 0.28
118 0.3
119 0.27
120 0.27
121 0.24
122 0.2
123 0.23
124 0.23
125 0.17
126 0.16
127 0.16
128 0.16
129 0.15
130 0.14
131 0.13
132 0.13
133 0.13
134 0.13
135 0.17
136 0.16
137 0.17
138 0.21
139 0.22
140 0.21
141 0.22
142 0.21
143 0.21
144 0.23
145 0.23
146 0.2
147 0.17
148 0.16
149 0.18
150 0.17
151 0.14
152 0.11
153 0.11
154 0.12
155 0.12
156 0.12
157 0.1
158 0.11
159 0.16
160 0.17
161 0.2
162 0.24
163 0.24
164 0.3
165 0.36
166 0.36
167 0.31
168 0.31
169 0.33
170 0.33
171 0.32
172 0.29
173 0.23
174 0.22
175 0.22
176 0.25
177 0.22
178 0.18
179 0.18
180 0.16
181 0.16
182 0.15
183 0.16
184 0.13
185 0.12
186 0.12
187 0.12
188 0.11
189 0.12
190 0.13
191 0.12
192 0.12
193 0.11
194 0.11
195 0.11
196 0.1
197 0.1
198 0.09
199 0.08
200 0.07
201 0.1
202 0.11
203 0.12
204 0.13
205 0.13
206 0.17
207 0.27
208 0.33
209 0.34
210 0.42
211 0.49
212 0.52
213 0.55
214 0.58
215 0.57
216 0.57
217 0.63
218 0.63
219 0.62
220 0.62
221 0.6
222 0.55
223 0.5
224 0.53
225 0.49
226 0.48
227 0.48
228 0.53
229 0.63
230 0.68
231 0.71
232 0.7
233 0.7
234 0.68
235 0.65
236 0.67
237 0.68
238 0.67
239 0.61
240 0.56
241 0.5
242 0.45
243 0.42
244 0.31
245 0.24
246 0.22
247 0.23
248 0.21
249 0.22
250 0.22
251 0.26
252 0.29
253 0.26
254 0.29
255 0.32
256 0.4
257 0.47
258 0.58
259 0.63
260 0.66
261 0.71
262 0.67
263 0.73
264 0.72
265 0.72
266 0.68
267 0.63
268 0.62
269 0.57
270 0.54
271 0.44
272 0.35
273 0.26
274 0.21
275 0.19
276 0.14
277 0.15
278 0.15
279 0.17
280 0.2
281 0.23
282 0.28
283 0.27
284 0.29
285 0.31
286 0.38
287 0.35
288 0.34
289 0.32
290 0.31
291 0.32
292 0.32
293 0.3
294 0.24
295 0.28
296 0.26
297 0.28
298 0.24
299 0.23
300 0.23
301 0.26
302 0.3
303 0.27
304 0.28
305 0.29
306 0.33
307 0.41
308 0.44
309 0.45
310 0.44
311 0.46
312 0.51
313 0.53
314 0.54
315 0.48
316 0.49
317 0.47
318 0.41
319 0.42
320 0.37
321 0.37
322 0.33
323 0.3
324 0.25
325 0.22
326 0.23
327 0.21
328 0.2
329 0.17
330 0.16
331 0.15
332 0.17
333 0.18
334 0.17
335 0.15
336 0.15
337 0.12
338 0.12
339 0.13
340 0.11
341 0.16
342 0.21
343 0.21
344 0.21
345 0.21
346 0.21
347 0.19
348 0.2
349 0.13
350 0.09
351 0.09
352 0.1
353 0.09
354 0.08
355 0.09
356 0.08
357 0.08
358 0.1