Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VVW6

Protein Details
Accession A0A2S4VVW6    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-184TKYDEKGKLREPNKKKKQPKPKKQLKKVQSKRKDEHNKBasic
NLS Segment(s)
PositionSequence
152-184KGKLREPNKKKKQPKPKKQLKKVQSKRKDEHNK
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR046798  2OG-FeII_Oxy_6  
Pfam View protein in Pfam  
PF20515  2OG-FeII_Oxy_6  
Amino Acid Sequences YLISNSNAFTCHLSFTLDNFYNEAHTNKDLSLCTFVTWIPINQQTGELEEDHFEVEGGEFVFPKDGCAVDFMRFNSIVECAWKASDHFHHTLPSPTPKGSPHTQLGISSQLPESAERALQTHQDEIPDYKKLWTIRDLEKVVKDAVTKYDEKGKLREPNKKKKQPKPKKQLKKVQSKRKDEHNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.26
4 0.26
5 0.26
6 0.24
7 0.24
8 0.23
9 0.24
10 0.24
11 0.19
12 0.18
13 0.18
14 0.18
15 0.21
16 0.19
17 0.19
18 0.22
19 0.18
20 0.17
21 0.17
22 0.16
23 0.17
24 0.17
25 0.15
26 0.16
27 0.19
28 0.2
29 0.2
30 0.21
31 0.18
32 0.19
33 0.19
34 0.15
35 0.12
36 0.12
37 0.12
38 0.11
39 0.1
40 0.08
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.08
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.1
55 0.11
56 0.11
57 0.13
58 0.13
59 0.15
60 0.15
61 0.15
62 0.13
63 0.12
64 0.11
65 0.1
66 0.1
67 0.08
68 0.08
69 0.08
70 0.08
71 0.1
72 0.14
73 0.17
74 0.19
75 0.19
76 0.2
77 0.2
78 0.23
79 0.22
80 0.23
81 0.2
82 0.19
83 0.2
84 0.2
85 0.24
86 0.24
87 0.26
88 0.23
89 0.24
90 0.24
91 0.23
92 0.23
93 0.21
94 0.19
95 0.15
96 0.13
97 0.12
98 0.12
99 0.12
100 0.11
101 0.09
102 0.09
103 0.08
104 0.09
105 0.1
106 0.13
107 0.14
108 0.15
109 0.15
110 0.15
111 0.16
112 0.17
113 0.19
114 0.18
115 0.17
116 0.16
117 0.2
118 0.21
119 0.23
120 0.25
121 0.28
122 0.32
123 0.39
124 0.41
125 0.4
126 0.4
127 0.39
128 0.35
129 0.31
130 0.27
131 0.2
132 0.21
133 0.22
134 0.22
135 0.22
136 0.3
137 0.34
138 0.35
139 0.39
140 0.43
141 0.48
142 0.54
143 0.63
144 0.64
145 0.71
146 0.79
147 0.85
148 0.88
149 0.89
150 0.93
151 0.94
152 0.95
153 0.95
154 0.95
155 0.95
156 0.96
157 0.96
158 0.95
159 0.95
160 0.94
161 0.94
162 0.94
163 0.93
164 0.89